SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000002090 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000002090
Domain Number 1 Region: 298-558
Classification Level Classification E-value
Superfamily Kelch motif 2.62e-62
Family Kelch motif 0.0000448
Further Details:      
 
Domain Number 2 Region: 30-139
Classification Level Classification E-value
Superfamily POZ domain 8.24e-34
Family BTB/POZ domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000002090   Gene: ENSMMUG00000001562   Transcript: ENSMMUT00000002212
Sequence length 586
Comment pep:known chromosome:MMUL_1:3:103128696:103148387:-1 gene:ENSMMUG00000001562 transcript:ENSMMUT00000002212 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAASGVEKNSKKKTEKKLAAREEAKLLAGFMGVMNNMRKQKTLCDVILMVQERKIPAHRV
VLAAASHFFNLMFTTNMLESKSFEVELKDAEPDIIEQLVEFAYTARISVNSNNVQSLLDA
ANQYQIEPVKKMCVDFLKEQVDASNCLGISVLAECLDCPELKATADDFIHQHFTEVYKTD
EFLQLDVKRVTHLLNQDTLTVRAEDQVYDAAVRWLKYDEPNRQPFMVDILAKVRFPLISK
NFLSKTVQAEPLIQDNPECLKMVISGMRYHLLSPEDREELVDGTRPRRKKHDYRIALFGG
SQPQSCRYFNPKDYSWTDIRCPFEKRRDAACVFWDNVVYILGGSQLFPIKRMDCYNVVKD
SWYSKLGPPTPRDSLAACAAEGKIYTSGGSEVGNSALYLFECYDTRTESWHTKPSMLTQR
CSHGMVEANGLIYVCGGSLGNNVSGRVLNSCEVYDPATETWTELCPMIEARKNHGLVFVK
DKIFAVGGQNGLGGLDNVEYYDIKLNEWKMVSPMPWKGVTVKCAAVGSIVYVLAGFQGVG
RLGHILEYNTETDKWVANSKVRAFPVTSCLICVVDTCGANEETLET
Download sequence
Identical sequences A0A2K6CQM4 F7G207 G7P0R2
ENSMMUP00000002090 9544.ENSMMUP00000002087 ENSMMUP00000002087 NP_001247571.1.72884 XP_011729455.1.29376

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]