SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000002273 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000002273
Domain Number 1 Region: 1-101
Classification Level Classification E-value
Superfamily ENTH/VHS domain 1.53e-31
Family VHS domain 0.00059
Further Details:      
 
Domain Number 2 Region: 153-225
Classification Level Classification E-value
Superfamily SH3-domain 3.02e-22
Family SH3-domain 0.0000868
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000002273
Domain Number - Region: 263-334
Classification Level Classification E-value
Superfamily GAT-like domain 0.00994
Family GAT domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000002273   Gene: ENSMMUG00000001700   Transcript: ENSMMUT00000002403
Sequence length 498
Comment pep:known chromosome:MMUL_1:9:17982152:18010968:1 gene:ENSMMUG00000001700 transcript:ENSMMUT00000002403 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PKDCLRSIMRRVNHKDPHVAMQALTLLGACVSNCGKIFHLEVCSRDFASEVSNVLNKGHP
KVCEKLKALMVEWTDEFKNDPQLSLISAMIKNLKEQGVTFPAIGSQAAEQAKASPALAAK
DPGTVANKKEEEDLAKAIELSLKEQRQQSTTLSTLYPSTSNLLTNHQHEGRKVRAIYDFE
AAEDNELTFKAGEIITVLDDSDPNWWKGETHQGIGLFPSNFVTADLTAEPEMIKTEKKTV
QFSDDVQVETIEPEPEPAFIDEDKMDQLLQMLQSTDPSDDQPDLPELLHLEAMCHQMGPL
IDEKLEDIDRKHSELSELNVKVMEALSLYTKLMNEDPMYSMYAKLQNQPYYMQSSGVSGS
QVYAGPPPSGAYLVAGNAQMSHLQSYSLPPEQLSSLSQAVVPPSTNPALPSQQTQAAYPN
TMVSSVQGNTYPSQAPVYSPPPAATAAAATADVTLYQNAGPSMSQVPNYNLTSSTLPQPG
GSQQPPQPQQPYSQKALL
Download sequence
Identical sequences 9544.ENSMMUP00000002273 ENSMMUP00000002273 ENSMMUP00000002273

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]