SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000002286 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000002286
Domain Number 1 Region: 191-577
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.59e-37
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0000552
Further Details:      
 
Domain Number 2 Region: 552-680
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 1.19e-31
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.000000846
Further Details:      
 
Domain Number 3 Region: 98-191
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.12e-25
Family Thioltransferase 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000002286   Gene: ENSMMUG00000001714   Transcript: ENSMMUT00000002418
Sequence length 682
Comment pep:known chromosome:MMUL_1:2:46344347:46422278:-1 gene:ENSMMUG00000001714 transcript:ENSMMUT00000002418 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LRVASEGSVRRPSAQVPAPPPPPAFRFVSRPGPAGSESENVEQSPPQSPGPGKAGDAPNR
RSGHVRGARVLSPPGRRARLSSPGPSSSSEAREELRRRLRGLIERSRVMIFSKSYCPHST
RVKELFSSLGVECNVLELDQVDDGAKVQEVLSEITNQKTVPNVFVNKVHVGGCDQTFQAY
QSGLLQKLLQEDSAYDYDLIIVGGGSGGLSCAKEAAILGKKVMVLDFVVPSPQGTSWGKL
FFSVRYNSPVSWIRKQASLGLAQSLMPSINYDWHTKYLMKHNWETMTKAIQNHISSLNWG
YRLSLREKAVAYVNSYGEFVEHHKIKATNKKGQETYYTAAQFVIATGERPRYLGIQGDKE
YCITSDDLFSLPYCPGKTLVVGASYVALECAGFLAGFGLDVTVMVRSILLRGFDQEMAEK
VGSYMEQHGVKFLRKFIPVMARWLTPVIPALWEAETGGSQGTETIEGVYNTVLLAIGRDS
CTRKMGLEKIGVKINEKSGKIPVNDVEQTSVPYVYAVGDVSEGKPELTPVAIQSGKLLAR
RLFGASLEKCDYINVPTTVFTPLEYGCCGLAEEKAIEVYKKENLEIYHTLFWPLEWTVAG
RENNTCYAKIICNKLDHDRVIGFHILGPNAGEVTQGFVAAMKCGLTKQLLDDTIGIHPTC
GEVFTTLEITKSSGLDITQKGC
Download sequence
Identical sequences ENSMMUP00000002286 ENSMMUP00000002286 9544.ENSMMUP00000002286

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]