SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000002298 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000002298
Domain Number 1 Region: 146-202,269-354
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 0.000000333
Family Bacterial lipase 0.097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000002298   Gene: ENSMMUG00000001722   Transcript: ENSMMUT00000002430
Sequence length 416
Comment pep:known chromosome:MMUL_1:6:89855137:90328985:-1 gene:ENSMMUG00000001722 transcript:ENSMMUT00000002430 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSISLSSLILLPIWINMAQIQQGGPDEKEKTTALKDLLSRIDLDELMKKDEPPLDFPDTL
EGFEYAFNEKGQLRHIKTGEPFVFNYREDLHRWNQKRYEALGEIITKYVYELLEKDCNLK
KISIPVDATESEPKSFIFMSEDALTNPQKLMVLIHGSGVVRAGQWARRLIINEDLDSGTQ
IPFIKRAVAEGYGVIVLNPNENYIEVEKPKIHVQSSSDSSDEPAEKRERKDKVSKETKKR
RDFYEKYRNPQREKEMMQLYIRENGSPEEHAIYVWDHFIAQAAAENVFFVAHSYGGLAFV
ELMIQREADVKNKVTAVALTDSVHNVWHQEAGKTIREWMRENCCNWVSSSEPLDTSVESM
LPDCPRVSAGTDRHELTSWKSFPSIFKFFTEASEAKISSLKPAVTRRSHRIKHEEL
Download sequence
Identical sequences A0A2I3N5Z0 A0A2K5JXJ6 A0A2K5Z7L9 A0A2K6NNJ4 G7P7Y3 I0FGB6
NP_001180816.1.72884 XP_001090460.2.72884 XP_005557430.1.63531 XP_005557431.1.63531 XP_005557432.1.63531 XP_007976699.1.81039 XP_007976708.1.81039 XP_011757080.1.29376 XP_011799654.1.43180 XP_011844839.1.47321 XP_014995890.1.72884 XP_015307179.1.63531 9544.ENSMMUP00000034334 ENSMMUP00000002298 ENSMMUP00000034334 ENSMMUP00000002298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]