SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000002336 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000002336
Domain Number 1 Region: 375-627
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.24e-71
Family Protein kinases, catalytic subunit 0.000000000222
Further Details:      
 
Domain Number 2 Region: 11-137
Classification Level Classification E-value
Superfamily SH2 domain 1.25e-32
Family SH2 domain 0.000000138
Further Details:      
 
Domain Number 3 Region: 148-260
Classification Level Classification E-value
Superfamily SH2 domain 2.56e-31
Family SH2 domain 0.000000451
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000002336   Gene: ENSMMUG00000001748   Transcript: ENSMMUT00000002471
Sequence length 635
Comment pep:known chromosome:MMUL_1:15:102617126:102712210:1 gene:ENSMMUG00000001748 transcript:ENSMMUT00000002471 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASSGMADNANHLPFFFGNITREEAEDYLVQGGMSDGLYLLRQSRNYLGGFALSVAHGRK
AHHYTIERELNGTYAIAGGRTHASPADLCHYHSQESDGLVCLLKKPFNRPQGVQPKTGPF
EDLKENLIREYVKQTWNLQGQALEQAIISQKPQLEKLIATTAHEKMPWFHGKISREESEQ
IVLIGSKTNGKFLIRARDNNGSYALCLLHEGKVLHYRIDKDKTGKLSIPEGKKFDTLWQL
VEHYSYKADGLLRVLTVPCQKIGTQGNVNFGGRPQLPGSHPATWSAGGIISRIKSYSFPK
PGHRKPSPAQGNRPESTVSFNPYEPEVAPWAAEKGPQREALPMDTEVYESPYADPEEIRP
KEVYLDRKLLTLEDKELGSGNFGTVKKGYYQMKKVVKTVAVKILKNEANDPALKDELLAE
ANVMQQLDNPYIVRMIGICEAESWMLVMEMAELGPLNKYLQQNRHVKDKNIIELVHQVSM
GMKYLEECNFVHRDLAARNVLLVTQHYAKISDFGLSKALRADENYYKAQTHGKWPVKWYA
PECINYYKFSSKSDVWSFGVLMWEAFSYGQKPYRGMKGSEVTAMLEKGERMGCPAGCPRE
MYDLMNLCWTYDVENRPGFAAVELRLRNYYYDVVN
Download sequence
Identical sequences A0A096P223 F7GLV6 G7PSP1
9544.ENSMMUP00000002336 ENSMMUP00000002336 ENSPANP00000019398 ENSMMUP00000002336 NP_001247964.1.72884 XP_005582280.1.63531 XP_005582281.1.63531 XP_005582282.1.63531 XP_014973556.1.72884 XP_014973557.1.72884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]