SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000002394 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000002394
Domain Number 1 Region: 988-1094
Classification Level Classification E-value
Superfamily PDZ domain-like 4.6e-27
Family PDZ domain 0.0000154
Further Details:      
 
Domain Number 2 Region: 271-378
Classification Level Classification E-value
Superfamily PDZ domain-like 1.97e-25
Family PDZ domain 0.00000428
Further Details:      
 
Domain Number 3 Region: 766-873
Classification Level Classification E-value
Superfamily PDZ domain-like 1.21e-23
Family PDZ domain 0.00000971
Further Details:      
 
Domain Number 4 Region: 626-724
Classification Level Classification E-value
Superfamily PDZ domain-like 7.89e-22
Family PDZ domain 0.0000166
Further Details:      
 
Domain Number 5 Region: 445-550
Classification Level Classification E-value
Superfamily PDZ domain-like 6.84e-19
Family PDZ domain 0.0000126
Further Details:      
 
Domain Number 6 Region: 1-112
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.3e-17
Family Nucleotide and nucleoside kinases 0.0072
Further Details:      
 
Domain Number 7 Region: 159-196
Classification Level Classification E-value
Superfamily WW domain 0.000000000000579
Family WW domain 0.0013
Further Details:      
 
Domain Number 8 Region: 206-241
Classification Level Classification E-value
Superfamily WW domain 0.00000000167
Family WW domain 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000002394   Gene: ENSMMUG00000001801   Transcript: ENSMMUT00000002531
Sequence length 1098
Comment pep:known chromosome:MMUL_1:3:138684578:139253307:1 gene:ENSMMUG00000001801 transcript:ENSMMUT00000002531 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TTRPHKEGEVPGVDYIFITVEDFMELEKSGALLESGTYEDNYYGTPKPPAEPAPLLLNVT
DQILPGATPSAEGKRKRNKSVSNMEKASIEPPEEEEEERPVVNGNGVVVTPESSEHEDKS
AGASGEMPSQPYPAPLYSQPEELKEQMDDTKPTKPEDSEEPDPLPDNWEMAYTEKGEVYF
IDHNTKTTSWLDPRLAKKAKPPEECKENELPYGWEKIDDPIYGTYYVDHINRRTQFENPV
LEAKRKLQQHNMPHTELGTKPLQAPGFREKPLFTRDASQLKGTFLSTTLKKSNMGFGFTI
IGGDEPDEFLQVKSVIPDGPAAQDGKMETGDVIVYINEVCVLGHTHADVVKLFQSVPIGQ
SVNLVLCRGYPLPFDPEDPANSMVPPLAIMERPPPVMVNGRHNYETYLEYISRTSQSVPD
ITDRPPHSLHSIPADGQLDGTYPPPVHDDNVSMASSGATQAELMTLTIVKGAQGFGFTIA
DSPTGQRVKQILDIQGCPGLCEGDLIVEINQQNVQNLSHTEVVDILKDCPIGSETSLIIH
RGGFFSPWKTPKPIMDRWENQGSPQTSLSAPAIPQNLPFPPALHRSSFPDSTEAFDPRKP
DPYELYEKSRAIYESRQQVPPRTSFRMDSSGKYCPDYKELDVHLRRMESGFGFRILGGDE
PGQPILIGAVIAMGSADRDGRLHPGDELVYVDGIPVAGKTHRYVIDLMHHAARNGQVNLT
VRRKVLCGGEPCPENGRSPGSVSTHHSSPRSDYATYTNSNHAAPSSNASPPEGFASHSLQ
TSDVVIHRKENEGFGFVIISSLNRPESGSTITVPHKIGRIIDGSPADRCAKLKVGDRILA
VNGQSIINMPHADIVKLIKDAGLSVTLRIIPQEELNSPTSAPSSEKQSPLAQQSPLAQQS
PLAQPSPATPNSPVAQPAPPQPLQLQGHENSYRSEVKARQDVKPDIRQPPFTDYRQPPLD
YRQPPGGDYQQPPPLDYRQPPLLDYRQHSPDTRQYPLSDYRQPQDFDYFTVDMEKGAKGF
GFSIRGGREYKMDLYVLRLAEDGPAIRNGRMRVGDQIIEINGESTRDMTHARAIELIKSG
GRRVRLLLKRGTGQVPEY
Download sequence
Identical sequences G7MM10 G7P1X6
ENSMMUP00000002394 9544.ENSMMUP00000002394 ENSMMUP00000002394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]