SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000002416 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000002416
Domain Number 1 Region: 262-325
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000000499
Family LIM domain 0.041
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000002416
Domain Number - Region: 320-346
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0034
Family LIM domain 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000002416   Gene: ENSMMUG00000001814   Transcript: ENSMMUT00000002554
Sequence length 352
Comment pep:known chromosome:MMUL_1:2:52381370:52416240:-1 gene:ENSMMUG00000001814 transcript:ENSMMUT00000002554 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QMSLGQLQSARGVACLGCKGTCSGFEPHSWRKICKSCKCSQEDHCLTSDLEDDRKIGRLL
MDSKYSTLTARVKGGDGIRIYKRNRMIMTNPIATGKDPTFDTITYEWAPPGVTQKLGLQY
MELIPKEKQPVTGTEGAFYRRRQLMHQLPIYDQDPSRCRGLLENELKLMEEFVKQYKSEA
LGVGEVALPGQGGLPKEEGKQQEKPEGAETTAATTNGSLSDPSKEVEYVCELCKGVAPPD
SPVVYSDRAGYSKQWHPTCFVCAKCSEPLVDLIYFWKDGAPWCGRHYCESLRPRCSGCDE
IIFSEDYQRVEDLAWHRKHFVCEGCEQLLSGRAYIVTKGQLLCPTCSKSKRS
Download sequence
Identical sequences 9544.ENSMMUP00000002416 ENSMMUP00000002416 ENSMMUP00000002416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]