SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000002418 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000002418
Domain Number 1 Region: 99-149
Classification Level Classification E-value
Superfamily Orange domain-like 0.0000000000000183
Family Hairy Orange domain 0.0025
Further Details:      
 
Domain Number 2 Region: 25-94
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000000000432
Family HLH, helix-loop-helix DNA-binding domain 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000002418   Gene: ENSMMUG00000001817   Transcript: ENSMMUT00000002557
Sequence length 221
Comment pep:known chromosome:MMUL_1:1:4073286:4074375:-1 gene:ENSMMUG00000001817 transcript:ENSMMUT00000002557 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAADTPGKPSASPMAGAPASASRTPDKPRSAAEHRKSSKPVMEKRRRARINESLAQLKTL
ILDALRKESSRHSKLEKADILEMTVRHLRSLRRVQVTAALNADPAVLGKYRAGFHECLAE
VNRFLADCEGVPADVRSRLLGHLAACLRQLGPSRRPASLPPAAPAEAPAPEVYAGRPLLP
SLGGPFPLLAPPLLPGLTGALPVAPRAGLQGQGGPWRPWLR
Download sequence
Identical sequences A0A1D5R597 A0A2K5TVF5
9544.ENSMMUP00000002418 ENSMMUP00000002418 ENSMMUP00000002418 XP_001090404.1.72884 XP_005545198.1.63531

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]