SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000002458 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000002458
Domain Number 1 Region: 584-790
Classification Level Classification E-value
Superfamily Fibronectin type III 1.5e-31
Family Fibronectin type III 0.00046
Further Details:      
 
Domain Number 2 Region: 406-491
Classification Level Classification E-value
Superfamily Immunoglobulin 1.4e-22
Family I set domains 0.012
Further Details:      
 
Domain Number 3 Region: 792-978
Classification Level Classification E-value
Superfamily Fibronectin type III 2.94e-22
Family Fibronectin type III 0.0003
Further Details:      
 
Domain Number 4 Region: 304-392
Classification Level Classification E-value
Superfamily Immunoglobulin 1.61e-20
Family I set domains 0.00069
Further Details:      
 
Domain Number 5 Region: 213-299
Classification Level Classification E-value
Superfamily Immunoglobulin 9.2e-20
Family I set domains 0.0026
Further Details:      
 
Domain Number 6 Region: 486-590
Classification Level Classification E-value
Superfamily Immunoglobulin 1.42e-17
Family I set domains 0.05
Further Details:      
 
Domain Number 7 Region: 13-105
Classification Level Classification E-value
Superfamily Immunoglobulin 1.04e-16
Family I set domains 0.00033
Further Details:      
 
Domain Number 8 Region: 113-192
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000577
Family I set domains 0.00045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000002458   Gene: ENSMMUG00000001847   Transcript: ENSMMUT00000002603
Sequence length 1016
Comment pep:known chromosome:MMUL_1:2:57953333:58502383:-1 gene:ENSMMUG00000001847 transcript:ENSMMUT00000002603 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TFSLLISDDSTLHGPIFIQEPSPVMFPLDSEEKKVKLNCEVKGNPKPHIRWKLNGTDVDI
GMDFRYSVVEGSLLINNPNKTQDAGTYQCTATNSFGTIVSREAKLQFAYLDNFKTRTRST
VSVRRGQGMVLLCGPPPHSGELSYAWIFNEYPSYQDNRRFVSQETGNLYIAKVEKSDVGN
YTCVVTNTVTNHKVLGPPTPLILRNDGVMGEYEPKIEVQFPETVPTAKGATVKLECFALG
NPVPTIIWRRADGKPIARKARRHKSNGILEIPNFQQEDAGLYECVAENSRGKNVARGQLT
FYAQPNWIQKINDIHVAMEENVFWECKANGRPKPTYRWLKNGEPLLTRDRIQIEQGTLNI
TIVNLSDAGMYQCLAENKHGVIFSNAELSVIAVGPDFSRTLLKRITLVKVGGEVVIECKP
KASPKPVYTWKKGRDILKENERITISEDGNLRIINVTKSDAGSYTCIATNHFGTASSTGN
LVVKDPTRVMVPPSSMDVTVGESIVLPCQVTHDHSLDIVFTWSFNGHLIDFDRDGDHFER
VGGQDSAGDLMIRNIQLKHAGKYVCMVQTSVDRLSAAADLIVRGPPGPPEAVTIDEITDT
TAQLSWRPGPDNHSPITMYVIQARTPFSVGWQAVNTVPELIDGKTFTATVVGLNPWVEYE
FRTVAANVIGIGEPSRPSEKRRTEEALPEVTPANVSGGGGSKSELVITWETVPEELQNGR
GFGYVVAFRPYGKMIWMLTVLASADASRYVFRNESVRPFSPFEVKVGVFNNKGEGPFSPT
TVVYSAEEEPTKPPASIFARSLSATDIEVFWASPLEKNRGRIQGYEVKYWRHEDKEENAR
KIRTVGNQTSTKITNLKGSALYHLAVKAYNSAGTGPSSATVNVTTRKPLYSLSPPPNEML
FSSLGRAASFSYKLKALDNESEVKGYKVLYRWNRQSSTSVIETNKTSVELSLPFDEDYII
EIKPFSDGGDGSSSEQIRIPKISNAYARGSGASTSNACTLSAISTIMISLTARSSL
Download sequence
Identical sequences ENSMMUP00000002458 ENSMMUP00000002457 9544.ENSMMUP00000002457

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]