SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000002487 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000002487
Domain Number 1 Region: 304-756
Classification Level Classification E-value
Superfamily Amine oxidase catalytic domain 1.01e-143
Family Amine oxidase catalytic domain 0.00000101
Further Details:      
 
Domain Number 2 Region: 44-149
Classification Level Classification E-value
Superfamily Amine oxidase N-terminal region 9.81e-33
Family Amine oxidase N-terminal region 0.0015
Further Details:      
 
Domain Number 3 Region: 161-292
Classification Level Classification E-value
Superfamily Amine oxidase N-terminal region 2.68e-25
Family Amine oxidase N-terminal region 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000002487   Gene: ENSMMUG00000001870   Transcript: ENSMMUT00000002633
Sequence length 756
Comment pep:known chromosome:MMUL_1:16:52965695:52971755:1 gene:ENSMMUG00000001870 transcript:ENSMMUT00000002633 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHLKIVLAFLALSLITIFALAYVLLTSPGGSSQPPHCPSVSHRAQPWPHPGQSQLFADLS
REELTAVMRFLTQRLGPGLVDAAQAQPSDNCIFSVELQLPPKAAALAHLDRGSPPPAREA
LAIVLFGGQPQPNVSELVVGPLPHPSYMRDVTVERHGGPLPYHRRPVLRAEFTQMWRHLK
EVELPKAPIFLASTFNYNGSTLAAVHATPRGLHSGDRATWMALHHNISGVGLFLHPVGLE
LLLDHRALDPAHWTVQRVFYLGHYYADLGQLEREFKSGRLEVVRVPLPPPNGASSLRSRN
SPGPLPPLQFSPQGSQYSVQGNLVVSSLWSFTFGHGVFSGLRIFDVRFQGERVAYEVSVQ
ECMSIYGADSPKTMLTRYLDSSFGLGRNSRGLVRGVDCPYQATMVDIHILVGKGAVQLLP
GAVCIFEEAQGLPLRRHHNYLENHFYGGLASSALVVRSVSSVGNYDYIWDFVLYPNGALE
GRVHATGYINTAFLKGGEEGLLFGNRVGERVLGTVHTHAFHFKLDLDVAGLKNWVVAEDV
VFKPVAAPWNPEHWLQRPQLTRQVLGKEDLTAFSLGSPLPRYLYLASNQTNAWGHQRGYR
IQIHSPLGIHLPLESDMERALSWGRYQLVVTQRKEEESQSSSIYHQNDIWTPTVTFADFI
NNETLLGEDLVAWVTASFLHIPHAEDVPNTVTLGNRVGFLLRPYNFFDEDPSIFSPGSVY
FEKGQDAGLCSINPVACLPDLAACVPDLPPFSYQGF
Download sequence
Identical sequences 9544.ENSMMUP00000002487 XP_002800533.1.72884 ENSMMUP00000002487 ENSMMUP00000002487

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]