SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000002488 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000002488
Domain Number 1 Region: 308-760
Classification Level Classification E-value
Superfamily Amine oxidase catalytic domain 3.01e-149
Family Amine oxidase catalytic domain 0.00000104
Further Details:      
 
Domain Number 2 Region: 48-153
Classification Level Classification E-value
Superfamily Amine oxidase N-terminal region 6.87e-33
Family Amine oxidase N-terminal region 0.0011
Further Details:      
 
Domain Number 3 Region: 165-294
Classification Level Classification E-value
Superfamily Amine oxidase N-terminal region 1.7e-24
Family Amine oxidase N-terminal region 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000002488   Gene: ENSMMUG00000001871   Transcript: ENSMMUT00000002634
Sequence length 763
Comment pep:known chromosome:MMUL_1:16:52972345:52979584:1 gene:ENSMMUG00000001871 transcript:ENSMMUT00000002634 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNQKTILVLLTLAVITIFALVCVLLVGRGGDGGEPSQLPHCASISPSAQPWTHPGQSQLF
ADLSREELTAVMHFLTQRLGPGLVDAAQARPSDNCVFSVELQLPPKTAALAHLDRGSPPP
AREALAIVFFGRQPQPNVSELVVGPLPHPSYMRDVTVERHGGPLPYHRRPVLFREYLDID
QMIFDRELPQASGLLHHCCFYKRRGRNLVTMTTAPRGLQSGDRATWFGLYYNISGAGFFL
HPVGLELLVNHKALDPARWTIQKVFYQGRYYDSLAQLEAQFEAGLVNVVLIPDNGTGGSW
SLKSPVPPGPAPPLQFHPQGPRFSVQGRRVASSLWTFSFGLGAFSGPRIFDVRFQGERLV
YEISLQEALAVYGGNSPAAMMTRYVDGGFGMGKYTTPLTRGVDCPYLATYVDWHFLLESQ
APKTIRDAFCVFEHNQGLPLRRHHSDLYSHYFGGLAETVLVVRSVSTLLNYDYVWDMVFH
PSGAIETRFYATGYISSAFLFGATGKYGNQVAEHTLGTVHTHSAHFKVDLDVGGLENWVW
AEDMVFVPMAVPWSPEHQLQRLQVTRKLLETEEQAAFLVGGTTPRYVYLASNHSNKWGHP
RGYRIQMLSFAGEPLPQNSSMARGFSWERYQLAVTQRKEEEPSSSSVFNQNDPWAPTVDF
SDFINNETIAGKDLVAWVTAGFLHIPHAEDIPNTVTVGNGMGFFLRPYNFFDEDPSFYSA
DSIHFRGDQDAEACEVNPLACLPQAAACAPDLPAFSHGGFSHN
Download sequence
Identical sequences 9544.ENSMMUP00000002488 ENSMMUP00000002488 ENSMMUP00000002488 XP_001112259.1.72884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]