SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000002568 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000002568
Domain Number 1 Region: 274-376
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 6.28e-22
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.00042
Further Details:      
 
Domain Number 2 Region: 31-104
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000000000131
Family HLH, helix-loop-helix DNA-binding domain 0.0022
Further Details:      
 
Domain Number 3 Region: 118-185
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000196
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000002568   Gene: ENSMMUG00000001919   Transcript: ENSMMUT00000002716
Sequence length 851
Comment pep:known chromosome:MMUL_1:5:73912198:73960272:1 gene:ENSMMUG00000001919 transcript:ENSMMUT00000002716 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLFTVSCSKMSSIVDRDDSSIFDGLVEEDDKDKAKRVSRNKSEKKRRDQFNVLIKELGSM
LPGNARKMDKSTVLQKSIDFLRKHKEITAQSDASEIRQDWKPTFLSNEEFTQLMLEALDG
FFLAIMTDGSIIYVSESVTSLLEHLPSDLVDQSIFNFIPEGEHSEVYKILSTHLLESDSL
TPEYLKSKNQLEFCCHMLRGTIDPKEPSTYEYVKFIGNFKSLNSVSSSAHNGFEGTIQRT
HRPSYEDRVCFVATVRLATPQFIKEMCTVEEPNEEFTSRHSLEWKFLFLDHRAPPIIGYL
PFEVLGTSGYDYYHVDDLENLAKCHEHLMQYGKGKSCYYRFLTKGQQWIWLQTHYYITYH
QWNSRPEFIVCTHTVVSYAEVRAERRRELGIEESLPETAADKSQDSGSDNRINTVSLKEA
LERFDHSPTPSASSRSSRKSSHTAVSDPSSTPTKIPTDTSTPPRQHLPAHEKMVQRRSSF
SSQSINSQSVGSSLTQPVMSQATNLPIPQGMSQFQFSAQLGAMQHLKDQVFLSTSLFLQS
SFLPVQILVRPLQETMTLVKGNGLSMFLQQSNPGLNFGSVQLSSGNSSNIQQLAPINMQG
QVVPTNQIQSGMNTGHIGTTQHMIQQQTLQSSTSTQSQQNVLSGHSQQTSLPSQTQSTLT
APLYNTMVISQPAAGSMVQIPSSMPQNSTQSAAVTTFTQDRQIRFSQGQQLVTKLVTAPV
ACGAVMVPSTMLMGQVVTAYPTFATQQQQSQTLSVTQQQQQQQQQSSQEQQLTSVQQPSQ
AQLTQPPQQFLQTSRLLHGNPSTQLILSAAFPLQQSTFSQSHHQQHQSQQQQQLSRHRTD
SLPDPSKVQPQ
Download sequence
Identical sequences 9544.ENSMMUP00000002568 ENSMMUP00000002568 ENSMMUP00000002568

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]