SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000002631 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000002631
Domain Number 1 Region: 103-195
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000324
Family Spectrin repeat 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000002631   Gene: ENSMMUG00000001973   Transcript: ENSMMUT00000002787
Sequence length 211
Comment pep:known chromosome:MMUL_1:1:117771680:117777922:-1 gene:ENSMMUG00000001973 transcript:ENSMMUT00000002787 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSCTIEKILTDAKTLLERLREHDAAAESLVDQSAALHRRVAAMREAGTALPDQVRQRYQE
DASDMKDMSKYKPHILLSQENTQIRDLQQENRELWISLEEHQDALELIMSKYRKQMLQLM
VAKKAVDAEPVLKAHQSHSAEIESQIDRICEMGEVMRRAVQVDDDQFCKIQEKLAQLELE
NKELRELLSISSESLQARKENSMDTASQAIK
Download sequence
Identical sequences A0A2K6AUN8 F7H9W4 G7NX36
ENSMMUP00000039346 9544.ENSMMUP00000039346 XP_005542293.1.63531 XP_011735269.1.29376 XP_015002703.1.72884 ENSMMUP00000002631

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]