SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000002686 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000002686
Domain Number 1 Region: 17-161
Classification Level Classification E-value
Superfamily Kelch motif 2.75e-21
Family Kelch motif 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000002686   Gene: ENSMMUG00000002007   Transcript: ENSMMUT00000002843
Sequence length 187
Comment pep:known chromosome:MMUL_1:1:139708418:139710360:1 gene:ENSMMUG00000002007 transcript:ENSMMUT00000002843 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVAVPPGRAAGSGWAWRPVARDALLARAFHSCTELRGRFYLVGGLLAGGTREPSSDTVV
FDPARGQTVRLGSRGSPPRSHHDAAPVGGRWLCVVGGWDGSRRLATVTALDTERDVWEAW
TATPGDCPPTGLSSHTCTRISDRELQVAGREGGIHTQRRYGSIYTLRLDPSARTYCYKQE
GCHIASR
Download sequence
Identical sequences 9544.ENSMMUP00000002686 ENSMMUP00000002686 ENSMMUP00000002686

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]