SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000002692 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000002692
Domain Number 1 Region: 608-914
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 2.36e-114
Family PDEase 0.0000000797
Further Details:      
 
Domain Number 2 Region: 199-398
Classification Level Classification E-value
Superfamily GAF domain-like 9.16e-47
Family GAF domain 0.0001
Further Details:      
 
Domain Number 3 Region: 382-584
Classification Level Classification E-value
Superfamily GAF domain-like 1.59e-42
Family GAF domain 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000002692   Gene: ENSMMUG00000002011   Transcript: ENSMMUT00000002849
Sequence length 933
Comment pep:known chromosome:MMUL_1:12:41244986:41539531:-1 gene:ENSMMUG00000002011 transcript:ENSMMUT00000002849 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAASRLDFGEVETFLDRHPELFEDYLMRKGKQEMVEKWLQRHSQGQGALGPRPSLAGTSS
LAHSTCKGGSSIGGGIGPNGSAHSQPLPGGGDCGGVPLSPSWASGSRGDGNLQRRASQKE
LRKSFARSKAIHVNRTYDEQATSRAQEPLSSVRRRALLRKASSLPPTTAHILSALLESRV
NLPQYPPTAIDYKCHLKKHNERQFFLELVKDISNDLDLTSLSYKILIFVCLMVDADRCSL
FLVERAAAGKKSLVSKFFDVHAGTPLLPCSSTENSNEVQVPWGKGIIGYVGEHGETVNIP
DAYQDRRFNDEIDKLTGYKTKSLLCMPIRSSDGEIIGVAQAINKIPEGAPFTEDDEKVMQ
MYLPFCGIAISNAQLFAASRKEYERSRALLEVVNDLFEEQTDLEKIVKKIMHRAQTLLKC
ERCSVLLLEDIESPVVKFTKSFELLSPKCSADAENSFKESMEKSSYSDWLINNSIAELVA
STGLPVNISDAYQDPRFDAEADQISGFHIRSVLCVPIWNSNHQIIGVAQVLNRLDGKPFD
DADQRLFEAFVIFCGLGINNTIMYDQVKKSWAKQSVALDVLSYHATCSKAEVDKFKAANI
PLVSELAINDIHFDDFSLDVDAMITAALRMFMELGMVQKFKIDYETLCRWLLTVRKNYRM
VLYHNWRHAFNVCQLMFAMLTTAGFQEILTEMEILAVIVGCLCHDLDHRGTNNAFQAKSG
SALAQLYGTSATLEHHHFNHAVMILQSEGHNIFANLSSKEYSDLMQLLKQSILATDLTLY
FERRTEFFELVSKGEYDWNIKNHRDVFRSMLMTACDLGAVTKPWEISRQASELVTSEFFE
QGDRERLELKLTPSAIFDRNRKDELPRLQLEWIDSICMPLYQALVKVNVKLKPMLDSVAA
NRSKWEELHQKRLLASTASSSPASVMVATEDRN
Download sequence
Identical sequences ENSMMUP00000002692 9544.ENSMMUP00000002693 ENSMMUP00000002693

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]