SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000002701 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000002701
Domain Number 1 Region: 1-62,90-126
Classification Level Classification E-value
Superfamily Translational machinery components 8.5e-37
Family Ribosomal protein L18 and S11 0.00097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000002701   Gene: ENSMMUG00000002017   Transcript: ENSMMUT00000002858
Sequence length 126
Comment pep:known chromosome:MMUL_1:11:52269074:52270061:1 gene:ENSMMUG00000002017 transcript:ENSMMUT00000002858 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIVRVTNRDIICHIAYARIEGDMIVCAAYAHELPKYGVKVGLTNYAAAYCTGLLLARRLL
NRFGIDMIYEGQVEVTGDEYNVESIDGQPGAFTCYLDAGLARTTTGNKVFGALKGAVDGG
LSIPHS
Download sequence
Identical sequences ENSMMUP00000002701 ENSMMUP00000002701 9544.ENSMMUP00000002701

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]