SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000002739 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000002739
Domain Number 1 Region: 1-86
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.57e-21
Family THAP domain 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000002739   Gene: ENSMMUG00000002047   Transcript: ENSMMUT00000002897
Sequence length 238
Comment pep:known chromosome:MMUL_1:1:9646074:9654017:1 gene:ENSMMUG00000002047 transcript:ENSMMUT00000002897 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPKSCAARQCCNRYSSRRKQLTFHRFPFSRPELLKEWVLNIGRGNFQPKQHTVICSEHFR
PECFSAFGNRKNLKHNAVPTVFAFQDPTQVRENTDPASERGNASSSQKEKGLPEGGAGED
SPGRKMDTALEELQLPPNAEGPVKQVSPWRPRATEVVGRPAGPAGLRRPPSKQPSDHSYA
LLDLDSLKKKLFLTLKENEKLRKRLQAQRLVMQRMSSRLRACKGHRGLQARLGPEQQS
Download sequence
Identical sequences 9544.ENSMMUP00000002738 ENSMMUP00000002739 XP_014998987.1.72884 ENSMMUP00000002738

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]