SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000002761 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000002761
Domain Number 1 Region: 143-479
Classification Level Classification E-value
Superfamily Subtilisin-like 2.88e-88
Family Subtilases 0.0000000249
Further Details:      
 
Domain Number 2 Region: 474-619
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.98e-36
Family Proprotein convertase P-domain 0.00077
Further Details:      
 
Domain Number 3 Region: 53-133
Classification Level Classification E-value
Superfamily Protease propeptides/inhibitors 0.00000000129
Family Prohormone convertase 1 pro-domain 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000002761   Gene: ENSMMUG00000002061   Transcript: ENSMMUT00000002921
Sequence length 786
Comment pep:known chromosome:MMUL_1:14:115603515:115632070:-1 gene:ENSMMUG00000002061 transcript:ENSMMUT00000002921 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPKGRQKVPHLDAPLGLPICLWLELAGLFLLVPWVMGLAGTGGPDGQGPGGPSWAVHLES
LKGDGEEETLEQQADALAQAAGLVNAGRIGELQGHYLFVQPAGHRPALEVEAIRQQVEAV
LAGHEAVRWHSEQRLLRRAKRSVHFNDPKYPQQWHLNNRRSPGRDINVTGVWERNVTGRG
VTVVVVDDGVEHTIQDIAPNYSPEGSYDLNSNDPDPMPHPDVENGNHHGTRCAGEIAAVP
NNSFCAVGVAYGSRIAGIRVLDGPLTDSMEAVAFNKHYQINDIYSCSWGPDDDGKTVDGP
HQLGKAALQHGVIAGRQGFGSIFVVASGNGGQHNDNCNYDGYANSIYTVTIGAVDEEGHM
PFYAEECASMLAVTFSGGDKMLRSIVTTDWDLQKGTGCTEGHTGTSAAAPLAAGMIALML
QVRPCLTWRDVQHIIVFTATRYEDRRAEWVTNEAGFSHSHQHGFGLLNAWRLVNAAKIWT
SVPYLASYVSPMLKENKAIPQSPRSLEVLWNVSRMDLEMSGLKTLEHVAVTVSITHPRRG
SLELKLFCPSGMMSLIGAPRSMDSDPNGFNDWTFSTVRCWGERARGTYRLVVRDVGDESF
QVGILRQWQLTLYGSVWSPVDIRDRQRLLESAMSGKYLHDDFTLPCPPGLKIPEEDGYTI
TPNTLKTLVLVGCFTVFWTVYYMLEVYLSQRNVASNQVCRSGPCHWPHRSRKAKEEGTEL
ESVPLCSSKDPDEVETESRGPPTTSDLLVPDLLEQGDWSLSQNNSTLDCPHQHLDDLLHG
KEEQIC
Download sequence
Identical sequences ENSMMUP00000002761 9544.ENSMMUP00000002761 ENSMMUP00000002761

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]