SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000002826 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000002826
Domain Number 1 Region: 69-335
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 2.91e-54
Family beta 1,4 galactosyltransferase (b4GalT1) 0.000000581
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000002826   Gene: ENSMMUG00000002124   Transcript: ENSMMUT00000002993
Sequence length 344
Comment pep:known chromosome:MMUL_1:10:14749661:14833928:1 gene:ENSMMUG00000002124 transcript:ENSMMUT00000002993 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMQAQGILIRDNVRTIGAQVYEQVLRSAYAKRNSSVNDSDYPLDLNHSETFLQTTTFLPE
DFTYFANHTCPERLPSMKGPIDINMSEIGMDYIHELFSKDPTIKLGGHWKPSDCMPRWKV
AILIPFRNRHEHLPVLFRHLIPMLQRQRLQFAFYVVEQVGTQPFNRAMLFNVGFQEAMKD
LDWDCLIFHDVDHIPESDRNYYGCGQMPRHFATKLDKYMYLLPYTEFFGGVSGLTVEQFR
KINGFPNAFWGWGGEDDDLWNRVQNAGYSVSRPEGDTGKYKSIPHHHRGEVQFLGRYALL
RKSKERQGLDGLNNLNYFANITYDALYKNITVNLTPELAQVNEY
Download sequence
Identical sequences A0A0D9RR85 F6UWL7 G7PG15
XP_011784219.1.43180 ENSMMUP00000002826 ENSMMUP00000002826 9544.ENSMMUP00000002826

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]