SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000002858 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000002858
Domain Number 1 Region: 42-142
Classification Level Classification E-value
Superfamily Cytochrome b5-like heme/steroid binding domain 1.7e-24
Family Steroid-binding domain 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000002858   Gene: ENSMMUG00000002142   Transcript: ENSMMUT00000003026
Sequence length 172
Comment pep:known chromosome:MMUL_1:1:157959751:157971688:-1 gene:ENSMMUG00000002142 transcript:ENSMMUT00000003026 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGPAPGRRLRPLAALALVLALAPGLPTARAGQTPRPAERGPPVRLFTEEELARYGGEEE
DQPIYLAVKGVVFDVTSGKEFYGRGAPYNALTGKDSTRGVAKMSLDPADLTHDTTGLTAK
ELEALDEVFTKVYKAKYPIVGYTARRILNEDGSPNLDFKPEDQPHFDIKDEF
Download sequence
Identical sequences A0A2K5WME9 A0A2K6CT18 F6UN10
XP_001108201.1.72884 XP_005540839.1.63531 XP_011759583.1.29376 ENSMMUP00000002858 9544.ENSMMUP00000002858 ENSMMUP00000002858

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]