SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000002874 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000002874
Domain Number 1 Region: 4-133
Classification Level Classification E-value
Superfamily NTF2-like 3.41e-36
Family NTF2-like 0.0029
Further Details:      
 
Domain Number 2 Region: 327-438
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.73e-19
Family Canonical RBD 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000002874   Gene: ENSMMUG00000002153   Transcript: ENSMMUT00000003042
Sequence length 482
Comment pep:known chromosome:MMUL_1:5:53910007:53938905:1 gene:ENSMMUG00000002153 transcript:ENSMMUT00000003042 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVMEKPSPLLVGREFVRQYYTLLNKAPEYLHRFYGRNSSYVHGGVDASGKPQEAVYGQND
IHHKVLSLNFSECHTKIRHVDAHATLSDGVVVQVMGLLSNSGQPERKFMQTFVLAPEGSV
PNKFYVHNDMFRYEDEVFGDSEPELDEESEDEVEEEQEERQPSPEPVQENANSGYYEAHP
VTNGIEEPLEESSHEPEPETESETKTEELKPQVEEKNLEELEEKSTTPPPAEPVSLPQEP
PKAFSWASVTSKNLPPSGTVSSSGIPPHVKAPVSQPRVEAKPEVQSQPPRVREQRPRERP
GFPPRGPRPGRGDMEQNDSDNRRIIRYPDSHQLFVGNLPHDIDENELKEFFMSFGNVVEL
RINTKGVGGKLPNFGFVVFDDSEPVQRILIAKPIMFRGEVRLNVEEKKTRAARERETRGG
GDDRRDIRRNDRGPGGPRGIVGGGMMRDRDGRGPPPRGGMAQKLGSGRGTGQMEGRFTGQ
RR
Download sequence
Identical sequences A0A2K6EAU5 G7MT20
9544.ENSMMUP00000002875 ENSMMUP00000002874 ENSMMUP00000002875 XP_011732011.1.29376 XP_011732012.1.29376 XP_011732013.1.29376 XP_011732014.1.29376 XP_014993997.1.72884 XP_014993999.1.72884 XP_014994000.1.72884 XP_014994001.1.72884 XP_014994002.1.72884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]