SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000002880 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000002880
Domain Number 1 Region: 87-264
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.54e-45
Family SPRY domain 0.0000171
Further Details:      
 
Domain Number 2 Region: 3-61
Classification Level Classification E-value
Superfamily RING/U-box 8.62e-16
Family RING finger domain, C3HC4 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000002880   Gene: ENSMMUG00000002159   Transcript: ENSMMUT00000003048
Sequence length 264
Comment pep:known chromosome:MMUL_1:4:151588555:151589349:-1 gene:ENSMMUG00000002159 transcript:ENSMMUT00000003048 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQNLQAELSCPVCLDFFSCPISLSCAHIFCFDCIQNWILENHDFRAMCPLCRDVVKAPP
LEEWQVRAIALIAKQHDNRLVQTLHVREELQRFREDVTLDAATASSLLVFSSDLRSAQRG
KIHHDLTKDPRLTCVLGTPCFSSGRHYWEVTVGEVKSWSLGVCKESADRNSSDLSPEHGF
WIISMEAGAIHANTDLERIPASPSLRHVGIFLDVDFEEIQFFDVDNNAHIYTHDSFFSLE
PLRPFFCLELLGEGESGNVLTICP
Download sequence
Identical sequences F6U9E0 G7P3M3
XP_001082916.1.72884 XP_015303910.1.63531 9544.ENSMMUP00000002880 ENSMMUP00000002880 ENSMMUP00000002880

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]