SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000002949 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000002949
Domain Number 1 Region: 339-415
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.39e-17
Family PCI domain (PINT motif) 0.033
Further Details:      
 
Domain Number 2 Region: 123-186,233-344
Classification Level Classification E-value
Superfamily TPR-like 0.0000201
Family Tetratricopeptide repeat (TPR) 0.024
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000002949
Domain Number - Region: 69-124
Classification Level Classification E-value
Superfamily TROVE domain-like 0.0131
Family TROVE domain-like 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000002949   Gene: ENSMMUG00000002207   Transcript: ENSMMUT00000003124
Sequence length 443
Comment pep:known chromosome:MMUL_1:18:55547046:55548377:1 gene:ENSMMUG00000002207 transcript:ENSMMUT00000003124 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDMEDDFTCDDEEDYDLEYSEDSNSEPNVDLENQYYNSKALKEDDSKAALSSFQKVLEL
EGEKGEWGFKALKQMIKINSKLTNFPEMMNRYKQLLTYIRSAVTRNYSEKSINSILDYIS
TSKQMDLLQEFYETTLEALKDAKNDRLWFKTNTKLGKLYLEREEYGKLQKILHQLHQSCQ
TDDGEDDLKKGTQLLEIYALEIQMYTAQKNNKKLKALYEQSLHIKSAIPHPLIMGVIREC
GGKMHLREGEFEKAHTDFFEAFKNYDESGSPRRTTCLKYLVLANMLMKSGINPFDSQEAK
PYKNDPEILAMTNLVSAYQNNDITEFEKILKTNHSNIMDDPFIREHIEELLRNIRTQVLI
KLIKPYTRIHIPFISKELNIDVADVESLLVQCILDNTIHGRTDQVNQLLELDHQKRGGAR
YTALDKWSNQLNSLNQAVVSKLA
Download sequence
Identical sequences ENSMMUP00000002949 ENSMMUP00000002949 9544.ENSMMUP00000002949

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]