SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000003018 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000003018
Domain Number 1 Region: 2-188
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.28e-59
Family F-box associated region, FBA 0.000000122
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000003018   Gene: ENSMMUG00000002261   Transcript: ENSMMUT00000003198
Sequence length 188
Comment pep:known chromosome:MMUL_1:1:14744271:14746294:-1 gene:ENSMMUG00000002261 transcript:ENSMMUT00000003198 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XQFYFLSKRRRNLLRNPCGEEDLEGWCDVEHGGDGWRVEELPGDSGVEFTHDESVKKYFA
SSFEWCRKAQIIDLQAEGYWEELLDTTQPAIVVKDCFNCWQIYAHIYVCMYVMYIFQNQS
AVQTKGHSVDWLWPQAGVRPTWNVIFHTFTDYGPGVRFVRFEHGGQDSVYWKGWFGARVT
NSSVWVEP
Download sequence
Identical sequences ENSMMUP00000003018 9544.ENSMMUP00000003018 ENSMMUP00000003018

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]