SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000003028 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000003028
Domain Number 1 Region: 25-294
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 1.09e-45
Family Carboxylesterase 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000003028   Gene: ENSMMUG00000002268   Transcript: ENSMMUT00000003208
Sequence length 307
Comment pep:known chromosome:MMUL_1:16:73482212:73501463:1 gene:ENSMMUG00000002268 transcript:ENSMMUT00000003208 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAISDVGLPGEVPWKKMSAEELENQYRPSQWVVRLGAEEALRTYSQIGIEATRRARATRK
SLLHVPYGDGEGEKVDIYFPDKAAEALPFFLFFHGGYWQSGSKDESAFMVDPLTAQGVAV
VIVAYDIAPKGTLDQMVDQVTRSVAFVQTRYPSNGGIYLCGHSAGAHLAAMMLLANWTKH
GVTPNLKGFFLVSGVFDLEPIMYTSQNIALQLTLEDAQRNSPQLKVAQAQPVDPTCRVLV
VVGQFDSPEFHRQSWEFYQVLSTQTLCQGEWKASFEQLHDVDHFEIVENLTQKDNVLTQI
ILKTIFQ
Download sequence
Identical sequences G7NH01 G7PSX7
9544.ENSMMUP00000003028 ENSMMUP00000003028 ENSMMUP00000003028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]