SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000003031 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000003031
Domain Number 1 Region: 35-451
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 1.23e-102
Family Serine carboxypeptidase-like 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000003031   Gene: ENSMMUG00000002269   Transcript: ENSMMUT00000003211
Sequence length 452
Comment pep:known chromosome:MMUL_1:16:41194569:41224386:1 gene:ENSMMUG00000002269 transcript:ENSMMUT00000003211 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELALRRSPVPGWLLLLPLLLGLSAGAVIDWPTEEGKEVWDYVTVRKDAYMFWWLYYATN
SCKNFSELPLVMWLQGGPGGSSTGFGNFEEIGPLDSDLKPRKTTWLQAASLLFVDNPVGT
GFSYVNGSGAYAKDLATVASDMMVLLKTFFDCHKEFQTVPFYIFSESYGGKMAAGIGLEL
YKAVQQGTIKCNFSGVALGDSWISPVDSVLSWGPYLYSMSLLEDKGLAEVSEVAEQVLSA
VNKGLYREATELWGKAEMIIERNTDGVNFYNILTKSTPTSTVESSLEFTQSHLVRLCQRH
VRHLQQDALSQLMNGPIRKKLKIIPEDQSWGGQATNVFVNMEEDFMKPVISIVDKLLKAG
INVTVYNGQLDLIVDTMGQEAWLRKLKWPELPKFSQLKWKALHSDPKSLETSAFVKSHKN
LAFYWILKAGHMVPSDQGDMALKMMRLVTQQE
Download sequence
Identical sequences G7PUE0 H9ZBZ0
9544.ENSMMUP00000003031 ENSMMUP00000003031 ENSMMUP00000003031 NP_001247955.1.72884 XP_005583857.1.63531

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]