SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000003041 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000003041
Domain Number 1 Region: 2-82
Classification Level Classification E-value
Superfamily ENTH/VHS domain 2.01e-24
Family ENTH domain 0.00043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000003041   Gene: ENSMMUG00000002272   Transcript: ENSMMUT00000003221
Sequence length 401
Comment pep:known chromosome:MMUL_1:6:154213269:154235659:-1 gene:ENSMMUG00000002272 transcript:ENSMMUT00000003221 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QSLLLLAYLIRNGSERVVTSAREHIYDLRSLENYHFVDEHGKDQGINIRQKVKELVEFAQ
DDDRLREERKKAKKNKDKYVGVSSDSVGGFRYSERYDPEPKSKWDEEWDKNKSAFPFSDK
LGELSDKIGSTIDDTISKFRRKDREDSPERCSDSDEEKKARRGRSPKGEFKDEEETVTTK
HIHITQATETTTTRHKRTANPSKTIDLGAAAHYTGDKASPDQNASTHTPQSSVKDIWFDP
SPPLPSPKLYIDVYLLFKSTGELLGGSADLFGGFADFGSAAASGSFPSQVTAASGNGDFG
DWSAFNQAPSGPVASSGEFFGSASQPAVELVSGSQSALGPPPAASNSSDLFDLMGSSQAT
MTSSQSMNFSMMSTNTVGLGLPMSRSQVSCLVPLEVVTYHL
Download sequence
Identical sequences ENSMMUP00000003041 9544.ENSMMUP00000003041 ENSMMUP00000003041

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]