SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000003053 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMMUP00000003053
Domain Number - Region: 109-206
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0115
Family FCH domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000003053   Gene: ENSMMUG00000002282   Transcript: ENSMMUT00000003233
Sequence length 227
Comment pep:known chromosome:MMUL_1:3:29588533:29589240:-1 gene:ENSMMUG00000002282 transcript:ENSMMUT00000003233 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVSSGKKYSRKSGKPSMEDQFTRAYDFETEDKKDLSGSEEDVIEGKTAVIEKGRRKDMGG
EVQNMLEGVGVDINKALLAKRKRLEMYTKASLKTSNQKIEHVWKTQQDQRQKLNQEYSQQ
FLTLFQQWDLDMQKAEEQEEKLNMFRQQQKILQQSRIVQSQRLKTIRQLYEQFIKSMEEL
EKNHDYLLTGAQNEFKKEMAMLQKKIMMETQQQEIASVWKSLQSMLF
Download sequence
Identical sequences ENSMMUP00000003053 9544.ENSMMUP00000003053 ENSMMUP00000003053

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]