SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000003069 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000003069
Domain Number 1 Region: 341-633
Classification Level Classification E-value
Superfamily Kelch motif 4.32e-68
Family Kelch motif 0.0000263
Further Details:      
 
Domain Number 2 Region: 69-189
Classification Level Classification E-value
Superfamily POZ domain 8.63e-32
Family BTB/POZ domain 0.0018
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000003069
Domain Number - Region: 270-349
Classification Level Classification E-value
Superfamily PheT/TilS domain 0.0994
Family B3/B4 domain of PheRS, PheT 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000003069   Gene: ENSMMUG00000002293   Transcript: ENSMMUT00000003249
Sequence length 655
Comment pep:known chromosome:MMUL_1:X:116189782:116258729:-1 gene:ENSMMUG00000002293 transcript:ENSMMUT00000003249 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLKWKTSSPAIWKFPVPVLKTSRSTPLSPAYISLVEEEDQHMKLSLGGSEMGLSSHLQS
SKAGPTRIFTSNTHSSVVLQGFDQLRLEGLLCDVTLMPGDTDDAFPVHRVMMASASDYFK
AMFTGGMKEQDLMCIKLHGVSKVGLRKIIDFIYTAKLSLNMDNLQDTLEAASFLQILPVL
DFCKVFLISGVTLDNCVEVGRIANTYNLTEVDKYVNSFVLKNFPALLSTGEFLKLPFERL
AFVLSSNSLKHCTELELFKATCRWLRLEEPRMDFAAKLMKNIRFPLMTPQELINYVQTVD
FMRTDNTCVNLLLEASNYQMMPYMQPVMQSDRTAIRSDTTHLVTLGGVLRQQLVVSKELR
MYDEKAHEWKSLAPMDAPRYQHGIAVIGNFLYVVGGQSNYDTKGKTAVDTVFRFDPRYNK
WMQVASLNEKRTFFHLSALKGYLYAVGGRNAAGELPTVECYNPRTNEWTYVAKMSEPHYG
HAGTVYGGVMYISGKQEFETRRANMVKPSICHNMWLKKAPMTTVRGLHCMCTVGERLYVI
GGNHFRGTSDYDDVLSCEYYSPILDQWTPIAAMLRGQSDVGVAVFENKIYVVGGYSWNNR
CMVEIVQKYDPDKDEWHKVFDLPESLGGIRACTLTVFPPEETTPSPSRESPLSAP
Download sequence
Identical sequences 9544.ENSMMUP00000003069 ENSMMUP00000003069 ENSMMUP00000003069

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]