SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000003099 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000003099
Domain Number 1 Region: 58-118
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000798
Family HLH, helix-loop-helix DNA-binding domain 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000003099   Gene: ENSMMUG00000002318   Transcript: ENSMMUT00000003282
Sequence length 336
Comment pep:known chromosome:MMUL_1:3:172710405:172737285:1 gene:ENSMMUG00000002318 transcript:ENSMMUT00000003282 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VGKIEVDKILIFNQEIRLRQHNSALHLIMATPEESSNAHDRATPQLPAQLQELEHRVARR
RLSQARHRATLAALFNNLRRTVYSQSDLTASKWQVLNKAKSHIPELEQTLDNLLKLKASF
NLEDGHASSLEEVKKEYASMYSGNDSFSQNGSSPWYLNFYKQTMDLLTGSGIITPQEAAL
PIVSAAISHLWQNLSEERKASLRQAWAQKHRGPASLAEACREPACAEGSVKDSGVDSQGA
SCSLVSTPEEILFEDAFDVASFLDKSEVPSTSSSSSMLASCNPENPEDKFQLYMQIIDFF
KGLSCANTQVKQEASFPVDEEMIMLQCTETFDDEDL
Download sequence
Identical sequences G7P0W2
9544.ENSMMUP00000003099 ENSMMUP00000003099 ENSMMUP00000003099

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]