SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000003117 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000003117
Domain Number 1 Region: 296-394
Classification Level Classification E-value
Superfamily Immunoglobulin 2.66e-24
Family I set domains 0.033
Further Details:      
 
Domain Number 2 Region: 199-292
Classification Level Classification E-value
Superfamily Immunoglobulin 1.37e-23
Family I set domains 0.0026
Further Details:      
 
Domain Number 3 Region: 401-497
Classification Level Classification E-value
Superfamily Immunoglobulin 1.36e-22
Family I set domains 0.024
Further Details:      
 
Domain Number 4 Region: 116-210
Classification Level Classification E-value
Superfamily Immunoglobulin 2.06e-22
Family I set domains 0.012
Further Details:      
 
Domain Number 5 Region: 507-607
Classification Level Classification E-value
Superfamily Fibronectin type III 8.76e-22
Family Fibronectin type III 0.000025
Further Details:      
 
Domain Number 6 Region: 10-110
Classification Level Classification E-value
Superfamily Immunoglobulin 7.67e-21
Family I set domains 0.03
Further Details:      
 
Domain Number 7 Region: 632-760
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000501
Family Fibronectin type III 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000003117   Gene: ENSMMUG00000002327   Transcript: ENSMMUT00000003301
Sequence length 1596
Comment pep:known chromosome:MMUL_1:2:3034843:3373849:-1 gene:ENSMMUG00000002327 transcript:ENSMMUT00000003301 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AGSRLRQEDFPPRIVEHPSDLIVSKGEPATLNCKAEGRPTPTIEWYKGGERVETDKDDPR
SHRMLLPSGSLFFLRIVHGRKSRPDEGVYVCVARNYLGEAVSHNASLEVAILRDDFRQNP
SDVMVAVGEPAVMECQPPRGHPEPTISWKKDGSPLDDKDERITIRGGKLMITYTRKSDAG
KYVCVGTNMVGERESEVAELTVLERPSFVKRPSNLAVTVDDSAEFKCEARGDPVPTVRWR
KDDGELPKSRYEIRDDHTLKIRKVMAGDMGSYTCVAENMVGKAEASATLTVQVGSEPPHF
VVKPRDQVVALGRTVTFQCEATGNPQPAIFWRREGSQNLLFSYQPPQSSSRFSVSQTGDL
TITNVQRSDVGYYICQTLNVAGSIITKAYLEVTDVIADRPPPVIRQGPVNQTVAVDGTLV
LSCVATGSPVPTILWRKDGVLVSTQDSRIKQLENGVLQIRYAKLGDTGRYTCIASTPSGE
ATWSAYIEVQEFGVPVQPPRPTDPNLIPSAPSKPEVTDVSRNTVTLSWQPNLNSGATPTS
YIIEAFSHASGSSWQTVAENVKTETFAIKGLKPNAIYLFLVRAANAYGISDPSQISDPVK
TQDVPPTSQGVDHKQVQRELGNVVLHLHNPTILSSSSIEVHWTVDQQSQYIQGYKILYRP
SGANHGESDWLVFEVRTPTKNSVVIPDLRKGVNYEIKARPFFNEFQGADSEIKFAKTLEE
GNAPPQGVTVSKNDGNGTAILVSWQPPPEDTQNGMVQEYKKKQAGISTCKIIFKTLSCLF
SDFEILIHGVRGKTEIIIQKLTKQWQPQVSACVIALNSHGNPVSPEDQVSLAQQISDVVK
QPAFIAGIGAACWIILMVFSIWLYRHRKKRNGLTSTYAGIRKVPSFTFTPTVTYQRGGEA
VSSGGRPGLLNISEPATQPWLADTWPNTGNNHNDCSINCCTAGNGNSDSNLTTYSRPADC
IANYNNQLDNKQTNLMLPESTVYGDVDLSNKINEMKTFNSPNLKDGRFVNPSGQPTPYAT
TQLIQSNLSNNMNNGSGDSGEKHWKPLGQQKQEVAPVQYNIMEQNKLNKDYRANDTIPPT
IPYNQSYDQNTGGSYNSSDRGSSTSGNQGHKKGARTPKVPKQGGMNWADLLPPPPAHPPP
HSNSEEYNISVDESYDQEMPCPVPPARMYLQQDELEEEEDERGPTPPVRGAASSPAAVSY
SHQSTATLTPSPQEELQPMLQDCPEETGHMQHPPDRRRQPVSPPPPPRPISPPHTYGYIS
GPLVSDMDTDAPEEEEDEADMEVAKMQTRRLLLRGLEQTPASSVGDLESSVTGSMINGWG
SASEEDNISSGRSSVSSSDGSFFTDADFAQAVAAAAEYAGLKVARRQVQDAAGRRHFHAS
QCPRPTSPVSTDSNMSAAIMQKTRPAKKPKHQPGHLRREAYTDDLPPPPVPPPAIKSPTV
QSKTQLEVRPVVVPKLPSIDARTERSSDRKGSSYKGREVLDGRPVVDVRTNPGDPREAQE
QQNDGKGRGNKGAKRDLLPAKTHLVQEDILPYCRPTFPTSNNPRDPSSSSSMSSRGSGSR
QREQANVGRRNIAEMQVLGGYERGEDNNEELEKTES
Download sequence
Identical sequences ENSMMUP00000003118 ENSMMUP00000003117

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]