SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000003194 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000003194
Domain Number 1 Region: 2475-2628
Classification Level Classification E-value
Superfamily SET domain 7.33e-47
Family Histone lysine methyltransferases 0.0064
Further Details:      
 
Domain Number 2 Region: 1203-1273
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000188
Family PHD domain 0.012
Further Details:      
 
Domain Number 3 Region: 1300-1370
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000487
Family PHD domain 0.013
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000003194
Domain Number - Region: 1165-1216
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000399
Family PHD domain 0.015
Further Details:      
 
Domain Number - Region: 1409-1474
Classification Level Classification E-value
Superfamily Bromodomain 0.0131
Family Bromodomain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000003194   Gene: ENSMMUG00000002381   Transcript: ENSMMUT00000003382
Sequence length 2628
Comment pep:known chromosome:MMUL_1:19:42199977:42220853:1 gene:ENSMMUG00000002381 transcript:ENSMMUT00000003382 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GNGAERVRVALRRGGGATGPGGAEPGEDTALLRLLGLRRGLRRLRRLWAGPRVQRGRGRG
RGRGWGPSRGCVPEEESSDGESDEEEFQGFHSDEDVAPSSLRSALRSQRGRAPRGRGRKH
KTTPLPPPRLADVAPTPSKTPARKRGEEGTERMVQALTELLRRAQAPPAPRSRACEPSTP
RRSRGRPPGRPAGPCRRKQQAVVVAEAAVTIPKPEPPPPVVPVKHQTGSWKCKEGPGPGP
GTPKRGGQSSRGGRGGRGRGRGGGLPFVIKFVSRAKRVKMGQLSLGLESGQGQGQHEETW
QDAPQRRVGSGQGGSPCWKKQEQKLDDEGEEKKEEEEKDKEEGEEKEERAVAEETMPAVE
KEETKLPPPPLTPPGPSPPPPLPPPSTSPPPPLCPPPPPPVSPPPLPSPPPPPAQEEQEE
SPPPVVPATCSRKRGRPPLTPSQRAEREAARAGPEGTSPPTPTPSTTTGGPPEDSPTVAP
KSTTFLKNIRQFIMPVVSARSSRVIKTPRRFMDEDPPRPPKVEVSPVLRPPITTSPLIPQ
EPAPVPSPPRAPTPPSTPVPLPEKRRSILREPTFRWTSLTRELPPPPPAPPPPPAPSPPP
APATSSRRPLLLRAPQFTPSEAHLKIYESVLTPPPLGAPEAPEPEPPPADDSPAEPEPRA
VGRTNHLSLPRFAPVVATPVKAEVSPHGAPALSNGPQTQAQLLQPLQALQTQLLPQALPP
PQPQLQPPPSPQQMPPLEKARIAGLGSLPLSGVEEKMFSLLKRAKVQLFKIDQQQQQKVA
ASMPPSPGGPMEEVAGALKQVSDRGPVRPEDESVEAKRERPSGPESPVQGPRIKHVCRHA
AVALGQARAMVPEDVPRLSALPLRDRQDLATEDTSSASETESVPSRSRRGKVETAGPGGD
SEPAGSGGTLAHTPRRSLPSHHGKKMRMARCGHCRGCLRVQDCGSCVNCLDKPKFGGPNT
KKQCCVYRKCDKIEARKMERLAKKGRTIVKTLLPWDSDESPEASPGPPGPRRGAGAGGPR
EEVVAPPGPEEQDSLLQRKSARRCVKQRPSYDIFEDSDDSEPGGPPAPRRRTPRENELPL
PEPEEQSRPRKPTLQPVLQLKARRRLDKDALAPGPFAAFPNGWTGKQKSPDGVHRVRVDF
KEDCDLENVWLMGGLSVLTSVPGGPPMVCLLCASKGLHELVFCQVCCDPFHPFCLEEAER
PLPQHHDTWCCRRCKFCHVCGRKGRGSKHLLECERCRHAYHPACLGPSYPTRATRKRRHW
ICSACVRCKSCGATPGKNWDVEWSGDYSLCPRCIQLYEKGNYCPICTRCYEDNDYESKMM
QCAQCDHWVHAKCEGLSDEDYEILSGLPDSVLYTCGPCAGAAQPRWREALSGALQGGLRQ
VLQGLLSSKVAGPLLLCTQCGPDGKQLHPGPCGLQAVSQRFEDGHYKSVHSFMEDMVGIL
MRHSEEGETPERRAGGQMKGLLLKLLESAFGWFDAHDPKYWRRSTRLPNGVLPNAVLPPS
LDHVYAQWRQQEPETPESGQPPGDPSAAFQGKDPAAFSHLEDPRQCALCLKYGDADSKEA
GRLLYIGQNEWTHVNCAIWSAEVFEENDGSLKNVHAAVARGRQMRCELCLKPGATVGCCL
SSCLSNFHFMCARASYCIFQDDKKVFCQKHTDLLDGKEIVNPDGFDVLRRVYVDFEGINF
KRKFLTGLEPDAINVLIGSIRIDSLGTLSDLSDCEGRLFPIGYQCSRLYWSTVDARRRCW
YRCRILEYRPWGPREEPAHLEAAEENQTIVHSPAPSSEPPGGEDPPLDTDVLVPGAPERH
SPIQNLDPPLRPDSGSAPPPAPRSFSGARIKVPNYSPSRRPLGGVSFGPLPSPGSPSSLT
HHIPTVGDPDFPAPPRRSRRPSPLAPRPPPSRRASPPLKTSPQLRVPPPTSVVTALTPTS
GELAPPGPAPSPPPPEDLGPDFEDMEVVSGLSAADLDFAASLLGTEPFQEEIVAAGAMGS
SHGGPGDSSEEEASPTSRYIHFPVTVVSAPGLAPSAPPGAPRIEQLDGVDDGTDSEAEAV
QQPRGQGTPPSGPGVGRAGVLGAAGDRARPPEDLPSEIVDFVLKNLGGPGEGGAGPREES
LPPAPPLANGSQPPQGLPASPADPTRTFAWLPGAPGVRVLSLGPAPEPPKPATSKIILVN
KLGQVFVKMAGGGEPVPPSGPASPPRQAIRVKRVSTFFGRSPPAPPPYLAPGLDEDGEAS
EDIPQVLGLGSGGFSRVRMKTPTVRGVLDLDRPGEPAGEESPGLLQERSPLLPLPEGGPP
QVTDAPPDLLLESQWHHYSGEASSSEEEPPSPDDKENQAPKRTGPHLRFEISSEDGFSVE
AESLEGAWRTLIEKVQEARGHARLRHLSFSGMSGARLLGIHHDAVIFLAEQLPGAQRCQH
YKFRYHQQGEGQEEPPLNPHGAARAEVYLRKCTFDMFNFLASQHRVLPEGATCDEEEDEV
QLRSTRRATSLELPMAMRFRHLKKTSKEAVGVYRSAIHGRGLFCKRNIDAGEMVIEYSGI
VIRSVLTDKREKFYDGKGIGCYMFRMDDFDVVDATMHGNAARFINHSCEPNCFSRVIHVE
GQKHIVIFALRRILRGEELTYDYKFPIEDASNKLPCNCGAKRCRRFLN
Download sequence
Identical sequences 9544.ENSMMUP00000003194 ENSMMUP00000003194 ENSMMUP00000003194

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]