SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000003209 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000003209
Domain Number 1 Region: 18-69,152-356
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 5.89e-23
Family Quinoprotein alcohol dehydrogenase-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000003209   Gene: ENSMMUG00000002390   Transcript: ENSMMUT00000003397
Sequence length 419
Comment pep:known chromosome:MMUL_1:13:27083241:27087151:-1 gene:ENSMMUG00000002390 transcript:ENSMMUT00000003397 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRRRAPELYRAPFPLYALQVDPSTGLLIAAGGGGAAKTGIKNGVHFLQLERINGRLSAS
LLHSHDTETRATMNLALAGDILAAGQDAHCQLLRFQAHQQKGNKAEKAGSKEQGPRQRKG
AAPAEKKCGGGAETQHEGLELRVENLQAVQTDFSSDPLQKVVCFNHDNTLLATGGTDGYV
RVWKVPSLEKVLEFKAHEGEIEDLALGPDGKLVTVGRDLKASVWQKNQLVTQLHWQENGP
TFSSTPYRYQACRFGQVPDQPAGLRLFTVQIPHKRLRQPPPCYLTAWDGSNFLPLRTKSC
GHEVISCLNVSESGTFLGLGTVTGSVAIYIAFSLQCLYYVREAHGIVVTDVAFLPEKGRG
PELLGSHETALFSVAVDSRCQLHLLPSRRSVPVWLLLLLCVGLIVVTILLLQSAFPGFL
Download sequence
Identical sequences A0A2K5X0C4 A0A2K6DLT7 F6PQ58
ENSMMUP00000003209 9544.ENSMMUP00000003209 NP_001253870.1.72884 XP_005576377.1.63531 XP_011736301.1.29376 ENSMMUP00000003209

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]