SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000003252 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000003252
Domain Number 1 Region: 612-780,807-908
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 4.63e-52
Family Pancreatic carboxypeptidases 0.0000116
Further Details:      
 
Domain Number 2 Region: 386-543
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.47e-46
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.00014
Further Details:      
 
Domain Number 3 Region: 908-1000
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 6.87e-21
Family Carboxypeptidase regulatory domain 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000003252   Gene: ENSMMUG00000002422   Transcript: ENSMMUT00000003442
Sequence length 1156
Comment pep:known chromosome:MMUL_1:3:82221893:82231621:-1 gene:ENSMMUG00000002422 transcript:ENSMMUT00000003442 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAVRGAPLLGCLLALLALCPGGRPQTVLTDDEIEEFLEGFLSELGPEPREDDMEAPPPP
EPTPRVRKAQAGGKPGARPGAAAEVPPEKTKDKGKKGKKDKGPKVPKESLEGSPKPPKKG
KEKPPKATKKPKEKPPKATKKPKEKPPKATKKPKEKPPKATKKPLSGKRPPTLAPSETLE
WPLPPPPSPGPEELPQEGGGPLPNNWQNPGEETRVEAREHQPEPEEETELPTLDYNDQIE
REDYEDFEYIRRQKQPRPPPSRRRRPERVWPEPPEEKAPAPAPAPEERIEPPVKPLLPLL
PPDYGDGYVIPNYDDMDYYFGPPPPQKPDAERQTDEEKEELKKPKKEDGRPKEETDKWAV
EKGKDHKEPRKGEEVEEEWTPTEKVKCPPIGMESHRIEDNQIRASSMLRHGLGAQRGRLN
MQAGATEDDYYDGAWCAEDDARTQWIEVDTRRTTRFTGVITQGRDSSIHDDFVTTFFVGF
SNDSQTWVMYTNGYEEMTFHGNVDKDTPVLSELPEPVVARFIRIYPLTWNGSLCMRLEVL
GCPVAPVYSYYAQNEVVATDDLDFRHHSYKDMRQLACAAGEQTVPQTLRCEVGLGPSSAA
LGLGRLLTEAPALAGEPEFRYTAGIHGNEVLGRELLLLLMQYLCREYRDGNPRVRSLVQD
TRIHLVPSLNPDGYEVAAQMGSEFGNWALGLWTEEGFDIFEDFPDLNSVLWGAEERKWVP
YRVPNNNLPIPERYLSPDATVSTEVRAIIAWMEKNPFVLGANLNGGERLVSYPYDMTRTP
TQEQLLAAAMAAARGEDEDEVSEAQETPDHAIFRWLAISFASAHLTLTEPYRGGCQAQDY
TGGMGIVNGAKWNPRSGTINDFSYLHTNCLELSFYLGCDKFPHESELPREWENNKEALLT
FMEQVHRGIKGVVTDEQGIPIANATISVSGINHGVKTASGGDYWRILNPGEYRVTAHAEG
YTPSAKTCNVDYDIGATQCNFILARSNWKRIREIMAMNGNRPIPHIDPSRPMTPQQRRLQ
QRRLQHRLRLRAQMRLRRLNATTTLGPTLCLPRCPCPATLSTTIEPGALYPTRWLGESET
ELHRVVTELGRGGAEFGTKVEPEFETQLETEFETQLELIEFEEEEEEEEEEEEEIATGQA
FPFTTVETYTVNFGDF
Download sequence
Identical sequences ENSMMUP00000003252 9544.ENSMMUP00000003252 ENSMMUP00000003252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]