SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000003272 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000003272
Domain Number 1 Region: 1-252
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.24e-82
Family Protein kinases, catalytic subunit 0.00000716
Further Details:      
 
Domain Number 2 Region: 510-637
Classification Level Classification E-value
Superfamily NTF2-like 7.25e-45
Family Association domain of calcium/calmodulin-dependent protein kinase type II alpha subunit, CAMK2A 0.000000488
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000003272   Gene: ENSMMUG00000002433   Transcript: ENSMMUT00000003462
Sequence length 645
Comment pep:known chromosome:MMUL_1:3:82057243:82117149:1 gene:ENSMMUG00000002433 transcript:ENSMMUT00000003462 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RGAFSVVRRCVKLCTGHEYAAKIINTKKLSARDHQKLEREARICRLLKHSNIVRLHDSIS
EEGFHYLVFDLCQGGGLRAAWTSPPSQVEGEAPHCIQQILEAVLHCHQMGVVHRDLKPEN
LLLASKCKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGYLSPEVLRKEAYGKPVDIWACG
VILYILLVGYPPFWDEDQHKLYQQIKAGAYDFPSPEWDTVTPEAKNLINQMLTINPAKRI
TAHEALKHPWVCQRSTVASMMHRQETVECLKKFNARRKLKGAILTTMLATRNFSVGRQTT
APATMSTAASGTTMGLVEQAKSLLNKKADGVKPQTNSTKNSAAATSPKGTLPPAALEPQT
TVIHNPVDGIKESSDSANTTIEDEDAKAPRVPDILSSVRRGSGAPEAEGPLPCPSPAPFS
PLPAPTPRISDILNSVRRGSGTPEAEGPLSAGPLPCLSPALLGPLPSPSPRISDILNSVR
RGSGTPEAEGPSPVGPLPCPSPTIPGPLPTPSRKQEIIKTTEQLIEAVNNGDFEAYAKIC
DPGLTSFEPEALGNLVEGMDFHRFYFENLLAKNSKPIHTTILNPHVHVIGEDAACIAYIR
LTQYIDGQGRPRTSQSEETRVWHRRDGKWQNVHFHCSGAPVAPLQ
Download sequence
Identical sequences 9544.ENSMMUP00000003272 ENSMMUP00000003272 ENSMMUP00000003272

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]