SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000003293 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000003293
Domain Number 1 Region: 11-102,130-233
Classification Level Classification E-value
Superfamily Translational machinery components 7.85e-35
Family Ribosomal protein L18 and S11 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000003293   Gene: ENSMMUG00000002444   Transcript: ENSMMUT00000003484
Sequence length 233
Comment pep:known chromosome:MMUL_1:6:81693997:81694729:1 gene:ENSMMUG00000002444 transcript:ENSMMUT00000003484 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGFVKVVKNQAHFERYRVKFRRRQEGKTDFCARKCLEIQDKNKYNTPKYRMIVCVTKIAY
ARIEGDMIVCASYSKYGVKVGLTNYALACWIDLLLAHWLLNRFGKDKIYESKVEVTGNEH
NVESIDGQPGAFICYLNAGLARNTTGNKVFGALKGVFDGGLSVPHSTKQFLGYDSESKEF
NAEVHQKHIMGQNVLEDIHYLMEDAYKKQFSQNINSVTPDMMEEMYKKAYAAI
Download sequence
Identical sequences ENSMMUP00000003293 ENSMMUP00000003293 9544.ENSMMUP00000003293

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]