SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000003305 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000003305
Domain Number 1 Region: 1214-1318,1372-1539
Classification Level Classification E-value
Superfamily Cullin homology domain 4.05e-41
Family Cullin homology domain 0.0006
Further Details:      
 
Domain Number 2 Region: 777-969
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 3.66e-36
Family APC10-like 0.0062
Further Details:      
 
Domain Number 3 Region: 360-434
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 2.8e-31
Family CPH domain 0.00000738
Further Details:      
 
Domain Number 4 Region: 120-195,473-562,637-829
Classification Level Classification E-value
Superfamily ARM repeat 0.00000107
Family PBS lyase HEAT-like repeat 0.065
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000003305
Domain Number - Region: 1549-1645
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0218
Family Penicillinase repressor 0.041
Further Details:      
 
Domain Number - Region: 961-1071
Classification Level Classification E-value
Superfamily Cullin repeat-like 0.0523
Family Cullin repeat 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000003305   Gene: ENSMMUG00000002451   Transcript: ENSMMUT00000003496
Sequence length 1697
Comment pep:known chromosome:MMUL_1:4:42925992:42942901:-1 gene:ENSMMUG00000002451 transcript:ENSMMUT00000003496 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVGELRYREFRVPLGPGLHAYPDELIRQRVGHDGHPEYQIRWLILRRGDEGDGGSGQVDC
KAEHILLWMSKDEIYANCHKMLGEDGQVIGPSQESSGEVGALDKSVLEEMETDVKSLIQR
ALRQLEECVGTIPPAPLLHTVHVLSAYASIEPLTGVFKDPRVLDLLMHMLSSPDYQIRWS
AGRMIQALSSHDAGTRTQILLSLSQQEAIEKHLDFDSRCALLALFAQATLSEHPMSFEGI
QLPQVPGRVLFSLVKRYLHVTSLLDQLNNSAAEPGAQNTSAPEELSGKRGQLELEFSMAM
GTLISELVQAMRWDQATDRPRSSARFPGSIFQPQLADVSPGFPTAQAQPSFRRSRRFRPR
SEFASGNTYALYVRDTLQPGMRVRMLDDYEEISAGDEGEFRQSNSGVPPVQVLWELTGRT
YWVHWHMLEILGFEEDVEDMVEADEYQGAVASRVLGRALPAWRWRPMTELYAVPYVLPED
EDTEECEHLTLAEWWELLFFIKKLDGPDHQEVLQILQENLDGEILDDEILAELAVPIELA
QDLLLTLPQRLNDSALRDLINCRVYKKYGPEALAGHSAYPSLLEAQQDVLLQAQAQVKDS
EDAAKVEAKEPPSQSPNTPLQHLVEDYGPAGKILLDLEQALSSEGTQENKVKPLLLQLQR
QPQPFLALMQSLDTPETNRALHLTVLRILKQLVDFPEALLLPWHEAVDACMACLRSPNTD
REVLQELIFFLHRLTSVSRDYAVVLNQLGARDAISKALEKHLGKLELAQELRDMVFKCEK
HAHLYRKLITNILGGCIQMVLGQIEDHRRTHRSINIPFFDVFLRYLCQGSSVEVKEDKCW
EKVEVSSNPHRASKLTDHNPKTYWESNGSAGSHYITLHMHQGVLIRQLTLLVASEDSSYM
PARVVVCGGDSASSLHTELNSVNVMPSASRVILLENLTRFWPIIQIRIKRCQQGGIDTRI
RGLEILGPKPTFWPVFREQLCRHTRLFYMVRAQAWSQDMAEDRRSLLHLSSRLNGALRQE
QNFADRFLPDDEAAQALGKTCWEALVSPVVQNITSPDEDGVSPLGWLLEQYLECQEAVFN
PQSRGPAFFSRVRRLTHLLVHVEPCEAPPPVAATPRPKGRNRSHDWSSLATQGLPSSIMR
NLTRCWQAVVEKQVNNFLTSSWRDDDFVPRYCEQFNILQNSSSELFGPRAAFLLALQNGC
AGALLKLPFLKAAHVSEQFARHIDQQIQGSRIGGAQEMERLAQLQQCLQAVLIFSGLEIA
TTFEHYYQHYMADRLLGVVSSWLEGAVLEQIGPCFPNRLPQQMLQSLSTSKELQRQFHVY
QLQRLDQELLKLEDTEKKIQVGHRDSGKEYKSEKEEGAGAAAAVDVTEGEEEEEENEDLY
YEGAMPEVSVLVLSRHCWPVASICHTLNPRTCLPSYLRGTLNRYSNFYNKSQSHPALEQG
SQRRLQWTWLGWAELQFGNQTLHVSTVQMWLLLYLNDLKAVSVESLLALSGLSEDMLNEA
IGPLTSSRGPLDLHEQKDIPGGVLKIRDGSKEPRSRWDIVRLIPPQTYLQAEGEEGRNLE
KRRNLLNCLIVRILKAHGDEGLHIDQLVCLVLEAWQKGPCPPRGLVSSLGRGSACSSTDV
LSCILHLLGKGTLRRHDDRPQVLSYAVPVTVMEPHTESLNPGSSGPNPPLTFHTLQIRSR
GVPYASCTATQSFSTFR
Download sequence
Identical sequences F7HH01
ENSMMUP00000003305 XP_001088003.2.72884 ENSMMUP00000003305 9544.ENSMMUP00000003305

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]