SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000003335 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000003335
Domain Number 1 Region: 322-542
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.3e-49
Family Reprolysin-like 0.0029
Further Details:      
 
Domain Number 2 Region: 1087-1143
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000196
Family TSP-1 type 1 repeat 0.0035
Further Details:      
 
Domain Number 3 Region: 980-1036
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000068
Family TSP-1 type 1 repeat 0.0023
Further Details:      
 
Domain Number 4 Region: 915-976
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000772
Family TSP-1 type 1 repeat 0.0042
Further Details:      
 
Domain Number 5 Region: 635-685
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000419
Family TSP-1 type 1 repeat 0.002
Further Details:      
 
Domain Number 6 Region: 1038-1082
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000575
Family TSP-1 type 1 repeat 0.0041
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000003335
Domain Number - Region: 143-153
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0549
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000003335   Gene: ENSMMUG00000002480   Transcript: ENSMMUT00000003527
Sequence length 1207
Comment pep:known chromosome:MMUL_1:6:125824676:126104173:1 gene:ENSMMUG00000002480 transcript:ENSMMUT00000003527 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLTHICCCCLLYQLGFLSNGIVSELQFAPDREEWEVVFPALWRREPVDTAGGSGGSADP
GWLRGVGAGGSARAQAPGSSREVRSVAPVPLEDPVEGRSESRLRPPPPSEGEEDEELESQ
ELPRGSSGAAALSPGAPASWQPPPPPQPPPSPPPAQPAEPDGDEVLLRIPAFSQDLYLLL
RRDGRFLAPRFAVEQRPNPGPGPTGAASAPHPPAPPDAGCFYTGAVLRHPGSLASFSTCG
GGLMGFIQLNEDFIFIEPLNDTMAITGHPHRVYRQKRSMEEKVTEKSALHSHYCGIISDK
GRPRSRKIAESGRGKRYSYKLPQEYNIETVVVADPAMVSYHGADAARRFILTILNMVFNL
FQHKSLGVQVNLRVIKLILLHETPPDLYIGHHGEKMLESFCKWQHEEFGKKNDIHLEMST
SWGEDMTSVDAAILITRKDFCVHKDEPCDTVGIAYLSGMCSEKRKCIIAEDNGLNLAFTI
AHEMGHNMGINHDNDHPSCADGLHIMSGEWIKGQNLGDVSWSRCSKEDLERFLRSKASNC
LLQTNPQSVNSVMVPSKLPGMTYTADEQCQILFGPLASFCQEMQHVICTGLWCKVEGEKE
CKTKLDPPMDGTDCDPGKWCKAGECTSRTSAPEHLAGEWSLWSPCSRTCSAGISSRERKC
PGLGSEARDCNGPRKQYRICENPPCPAGLPGFRDWQCQAYSVRTSSPKHVLQWQAVLDEE
KPCALFCSPVGKEQPILLSEKVMDGTSCGYQGLDICANGRCQKVGCDGLLGSLAREDHCG
VCNGNGKSCKIIKGDFNHTRGAGYVEVLVIPAGARRIKVVEEKPAHSYLALRDAGKQSIN
SDWKIEHSGAFNLAGTTVHYVRRGLWEKISAKGPTTAPLHLLVLLFQDQNYGLHYEYTIP
SDPLPENQSSKAPEPLFMWTHTSWEDCDATCGGGERKTTVSCTKIMSKNISIVDNKKCKY
LTKPEPQIRKCNEQPCQTRWMMTEWTPCSRTCGKGMQSRQVACTQQLSNGTLIRARERDC
IGPKPASAQRCEGQDCMTVWEAGVWSECSVKCGKGVRHRTVRCTNPRKKCVLSTRPREAE
DCEDYSKCYVWRMGDWSKCSITCGKGMQSRVIQCMHKITGRHGNECFSSEKPAAYRPCHL
QPCNEKINVNTITSPRLAALTFKCLGDQWPVYCRVIREKNLCQDMRWYQRCCETCRDFYA
RKLQQKS
Download sequence
Identical sequences ENSMMUP00000003335 ENSMMUP00000003335 9544.ENSMMUP00000003335

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]