SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000003347 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000003347
Domain Number 1 Region: 241-443
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 2.2e-48
Family Reprolysin-like 0.0022
Further Details:      
 
Domain Number 2 Region: 535-590
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000122
Family TSP-1 type 1 repeat 0.00036
Further Details:      
 
Domain Number 3 Region: 950-1003
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000798
Family TSP-1 type 1 repeat 0.0024
Further Details:      
 
Domain Number 4 Region: 827-888
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000196
Family TSP-1 type 1 repeat 0.005
Further Details:      
 
Domain Number 5 Region: 891-950
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000209
Family TSP-1 type 1 repeat 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000003347   Gene: ENSMMUG00000002488   Transcript: ENSMMUT00000003541
Sequence length 1186
Comment pep:known chromosome:MMUL_1:6:175726148:175961497:-1 gene:ENSMMUG00000002488 transcript:ENSMMUT00000003541 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PPLLPPPPPANARLAAAADPPGGPLGHGAERILAVPVRTDAQGRLVSHVVSAATARAGVR
ARRAAPVRTPSFPGGNEEDPGSHLFYNVTVFGRDLHLRLRPNARLVAPGATMEWQGETGT
TRVEPLLGSCLYVGDVAGLAEASSVALSNCDGLAGLIRMEEEEFFIEPLEKGLAAQEAEQ
GRVHVVYRRPPKSPPLVGPQALDTGASLGNLDSLSRTLGVLEERVNSSRRRARRHAADDD
YNIEVLLGVDDSVVQFHGKEHVQKYLLTLMNIVNEIYHDESLGAHINVVLVRIILLSYGK
SMSLIEIGNPSQSLENVCRWAYLQQKPDTDHDEYHDHAIFLTRQDFGPSGMQGYAPVTGM
CHPVRSCTLNHEDGFSSAFVVAHETGHVLGMEHDGQGNRCGDEVRLGSIMAPLVQAAFHR
FHWSRCSQQELSRYLHSYDCLRDDPFAHDWPALPQLPGLHYSMNEQCRFDFGLGYMMCTA
FRTFDPCKQLWCSHPDNPYFCKTKKGPPLDGTMCAPGKHCFKGHCIWLTPDILKRDGNWG
AWSPFGSCSRTCGTGVKFRTRQCDNPHPANGGRTCSGLAYDFQLCSRQDCPDSLADFREE
QCRQWDLYFEHGDAQHHWLPHEHRDAKERCHLYCESRETGEVVSMKRMVHDGTRCSYKDA
FSLCVRGDCRKVGCDGVIGSSKQEDKCGVCGGDNSHCKVVKGTFTRSPKKHGYIKMFQIP
AGARHLLIQEVDATNHHLAVKNLETGKFILNEENDVDASSKTFIAMGVEWEYRDEDGRET
LQTMGPLHGTITVLVIPAGDTRVSLTYKYMIHEDSLNVDDNNVLEDDSVVYEWALKKWSP
CSKPCGGGSQFTKYGCRRRLDHKMVHRGFCAALSKPKAIRRACNLQECSQPVWVTGEWEP
CSHSCGRTGMQVRSMRCIQPLHNNTTRSVHTKHCNDARPESRRACNRELCPGRWRAGPWS
QCSVTCGNGTQERPVLCRTADDSFGICQEERPETARICRLGPCPRNISDPSKKSYVVQWL
SRPDPDSPIRKISSKGHCQGDKSIFCRMEVLSRYCSIPGYNKLCCKSCDLHNNLTSVEGR
TQPPPGKHNDIDVFMPTLPVPTVVTEVQPSPSTPLDVPLNVSSTNATEDHPETNAVDEPY
KIHGLEDEVQPPNLIPRRPSPYEKTRNQRIQELIDEMRKKEMLGKF
Download sequence
Identical sequences ENSMMUP00000003347 9544.ENSMMUP00000003347 ENSMMUP00000003347

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]