SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000003362 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000003362
Domain Number 1 Region: 17-112
Classification Level Classification E-value
Superfamily Coiled-coil domain of nucleotide exchange factor GrpE 0.000000000235
Family Coiled-coil domain of nucleotide exchange factor GrpE 0.0061
Further Details:      
 
Domain Number 2 Region: 116-164
Classification Level Classification E-value
Superfamily Head domain of nucleotide exchange factor GrpE 0.0000418
Family Head domain of nucleotide exchange factor GrpE 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000003362   Gene: ENSMMUG00000002500   Transcript: ENSMMUT00000003557
Sequence length 166
Comment pep:known scaffold:MMUL_1:1099214818572:487:1127:-1 gene:ENSMMUG00000002500 transcript:ENSMMUT00000003557 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QTKWGTDTPSTDKILMEEVKLEEQLKEAVEEDKQALADTEGSQQSSQKLVEAANMYSIQG
FCEDSLEVADVLEKATLCVPEEEIKDNNPHLKNLCETLTMSEVQFQEVFSKHAKPNPVSA
KFHPYEHAVFFSSGKELSPVVLVTKVRFKLHGQLLRPALVGVVKKA
Download sequence
Identical sequences ENSMMUP00000003362 9544.ENSMMUP00000003362 ENSMMUP00000003362

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]