SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000003363 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000003363
Domain Number 1 Region: 79-295
Classification Level Classification E-value
Superfamily VPS9 domain 2.62e-43
Family VPS9 domain 0.000000387
Further Details:      
 
Domain Number 2 Region: 14-50
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000299
Family A20-like zinc finger 0.00091
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000003363
Domain Number - Region: 310-382
Classification Level Classification E-value
Superfamily PAZ domain 0.0549
Family PAZ domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000003363   Gene: ENSMMUG00000002502   Transcript: ENSMMUT00000003559
Sequence length 400
Comment pep:known scaffold:MMUL_1:1099548049469:34767:63637:-1 gene:ENSMMUG00000002502 transcript:ENSMMUT00000003559 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSPKSERGGIHVDLCKKGCGYYGNPVWQGFCSKHWREKYHKEMQEDWELAERLQREEEEA
FASSQSSQGAQSLTFSKFEEKKTNEKTREVTTVKKFFSASSRVGSKKGIKRIEKWLQSLK
IYVVTQLSAKIWCKFHTSEQEGKSKGKQNSNKSTNTATWQVMCFVPCTLHSSQIKELNMK
KLRNIIEMDSKRVPRDKLACITKCSKHIFNAIKITKNEPASADDFLPTLMYIVLKDPPPL
QSNIQYITRFCNPSRLMTGEDGYYFTNLCCAVAFIEKLDAQSLNLSQEDFDRYMSGQTSP
RKQEAESWSPDACLGVKQMYKNLDLLSQLNERQERIMNEAKKLEKDLIDWTDGITREVQD
IVEKYPLEIKPPNQPLVAVDSENIENDKLPPPLQPQVCAG
Download sequence
Identical sequences 9544.ENSMMUP00000003363 ENSMMUP00000003363 ENSMMUP00000003363

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]