SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000003435 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000003435
Domain Number 1 Region: 89-136
Classification Level Classification E-value
Superfamily Cysteine-rich DNA binding domain, (DM domain) 5.49e-17
Family Cysteine-rich DNA binding domain, (DM domain) 0.0003
Further Details:      
 
Domain Number 2 Region: 322-366
Classification Level Classification E-value
Superfamily UBA-like 0.000000536
Family CUE domain 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000003435   Gene: ENSMMUG00000002551   Transcript: ENSMMUT00000003632
Sequence length 501
Comment pep:known chromosome:MMUL_1:15:54599732:54604567:-1 gene:ENSMMUG00000002551 transcript:ENSMMUT00000003632 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEQSHCGSRDRGGSGRPHLAPGLVVAAAPPPPSPALPVPSGMQVPPAFLRPPSLFLRAAA
AAAATSGSGGCPPPPGLERGVGAVGCGYPRTPKCARCRNHGVVSALKGHKRFCRWRDCAC
AKCTLIAERQRVMAAQVALRRQQAQEESEARGLQRLLCSGLSGPPGGRAPGGSGRAENPQ
SAGGPAAGAALGQGALRQASGSATPTFEVFQQDYPEEKQEQKESKCESCQNGQEEPISKS
HQLYLGSSPRSNGVVGKQSIGSSILEYSNKHDSVLSPHPGEQSGGEESPRSLSSSDLESG
NESEWVKDLTATKASLPTVSSRPRDPLDILTKIFPNYRRSRLEGILQFCKGDVVQAIEQV
LNGREHKPDNRNLANSEELENTAFQRASSFSLAGIGFGTLGNKSAFSPLQTTSASYGGDS
NLYSLNPRVGISPLRVAYSSVGRGLSGFMSPYLTPGLVPTLPFRPALDYAFSGMIRDSSY
LSSKDSITCGRLYFRPNQDNL
Download sequence
Identical sequences 9544.ENSMMUP00000003435 ENSMMUP00000003435 ENSMMUP00000003435

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]