SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000003510 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000003510
Domain Number 1 Region: 100-381
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 4.87e-40
Family Galactosyltransferase LgtC 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000003510   Gene: ENSMMUG00000002611   Transcript: ENSMMUT00000003716
Sequence length 731
Comment pep:known chromosome:MMUL_1:14:26205017:26211084:-1 gene:ENSMMUG00000002611 transcript:ENSMMUT00000003716 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPRGRPRALGAAALLLLLLLLGFLLFGGDLGCERRKRGGRAGAPGCFPGPLMPRVPPDG
RLRRAAALDGDPGAGPGDHNRSDCGPPPPRPSKCELLHVAIVCAGHNSSRDVITLVKSML
FYRKNPLHLHLVTDAVARNILEMLFHTWMVPAVRVSFYNADELKAGAQPFPAPPSCVSWI
PNKHYSGLYGLMKLVLPSALPTELAHVIVLDTDVTFASDISELWALFAHFSDTQAIGLVE
NQSDWYLGNLWKNHRPWPALGRGFNTGVILLRLDRLRQAGWEQMWRLTARRELLTLPATS
LADQDIFNAVIKEHPGLVQPLPCVWNVQLSDHTLAERCYSAASDLKVIHWNSPKKLQVKN
KHVEFFRNFYLTFLEYDGNLLRRELFGCPSQPPPGAEQLQQALSQLNEEDPCFEFRQQQL
TVHRVHVTFLPHEPPPPRPHDVTLVAQLSMDRLQMLEALCRHWPGPMSLALYLTDAEAQQ
FLRFIEASPVLAARQDVAYHVVYREGPLYPVNQLRNVALAQALTPYVFLSDIDFLPAYSL
YDYLRASIEQLGLGSQRKAALVVPAFETLHYRFSFPHSKVELLALLDVGALYTFRYHEWP
RGHAPTDYARWREAQDPYRVQWAADYEPYVVVPRDCPRYDPRFVGFGWNKVAHIVELDAQ
EYELLVLPEAFTIHLPHAPSLDISRFRSSPTYRDCLQALKDEFHQDLSRHHGAAALKYLP
ALQQPQSPARD
Download sequence
Identical sequences ENSMMUP00000003510 9544.ENSMMUP00000003510 ENSMMUP00000003510

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]