SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000003519 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000003519
Domain Number 1 Region: 29-131
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000197
Family I set domains 0.0011
Further Details:      
 
Domain Number 2 Region: 124-218
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000185
Family Fibronectin type III 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000003519   Gene: ENSMMUG00000002619   Transcript: ENSMMUT00000003725
Sequence length 220
Comment pep:known chromosome:MMUL_1:4:135641229:135702602:1 gene:ENSMMUG00000002619 transcript:ENSMMUT00000003725 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VRAKACAPLAHVLTQEFLILNLFLRDKSPHFLRLGDVEVNAGQNATFQCIATGRDAVHNK
LWLQRRNGEDIPVAQTKNINHRRFAASFRLQEVTKTDQDLYRCVTQSERGSGVSNFAQLI
VREPPRPIAPPQLLGVGPTYLLIQLNANSIIGDGPIILKEVEYRMTSGSWTETHAVNAPT
YKLWHLDPDTEYEIRVLLTRPGEGGTGLPGPPLITRTKCA
Download sequence
Identical sequences ENSMMUP00000003519 ENSMMUP00000003519 9544.ENSMMUP00000003519

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]