SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000003631 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000003631
Domain Number 1 Region: 2-229
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 3.92e-66
Family IMD domain 0.000021
Further Details:      
 
Domain Number 2 Region: 326-408
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000144
Family SH3-domain 0.00042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000003631   Gene: ENSMMUG00000002699   Transcript: ENSMMUT00000003841
Sequence length 529
Comment pep:known chromosome:MMUL_1:10:82021852:82052388:-1 gene:ENSMMUG00000002699 transcript:ENSMMUT00000003841 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPEMDQFYRSTMAIYKSIMEQFNPALENLVYLGNNYLRAFHALSEAAEVYFSAIQKIGE
RALQSPTSQILGEILVQMSDTQRHLNSDLEVVVQTFHGDLLQHMEKNTKLDMQFIKDSRQ
HYELEYRHRAANLEKCMSELWRMERKRDKNVREMKESVNRLHAQMQAFVSESQRAAELEE
KRRYRFLAEKHLLLSNTFLQFFGRARGMLQNRVLLWKEQSEASRSPSRAHSPGLLGPALG
PPYPSGRLTPTRLDMPPRPLGEFSSPRSRHGSGSYGPEPSARPASQLEPDRRSLPRTPSA
SSLYSGSTQSSRSNSFGERPGGGGGARRVRALVSHSEGANHTLLRFSAGDVVEVLVPEAQ
NGWLYGKLEGSSASGWFPEAYVKALEEGPVNPITPVTPMTSMSPMTPMMPVKPGNELPSR
SYPLRGSHSLNDLLDRPGNSTAPSEYWDGQSRSRTPSRVPSRAPSPAPPPLPSSRRGSMG
STGTATDVKKLMSSEQYPPQELFPRGTNPFATVKLRPTITNDRSAPLIR
Download sequence
Identical sequences A0A2K5W882 F6R1S4
ENSMMUP00000003631 ENSMMUP00000037013 9544.ENSMMUP00000037013 XP_001092417.1.72884 XP_005567375.1.63531

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]