SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000003664 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000003664
Domain Number 1 Region: 18-354
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 6.79e-105
Family Pancreatic lipase, N-terminal domain 0.0000000000175
Further Details:      
 
Domain Number 2 Region: 354-467
Classification Level Classification E-value
Superfamily Lipase/lipooxygenase domain (PLAT/LH2 domain) 3.36e-38
Family Colipase-binding domain 0.00000287
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000003664   Gene: ENSMMUG00000002724   Transcript: ENSMMUT00000003877
Sequence length 467
Comment pep:known chromosome:MMUL_1:9:116220484:116239377:1 gene:ENSMMUG00000002724 transcript:ENSMMUT00000003877 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLIFWTITLFLLGAAKGKEVCYEDLGCFSDTEPWGGTAIRPLKILPWTPEKIGTRFLLYT
NENPNNFQILLPSDPSTIEASNFQTDRKTRFIIHGFIDKGDERWVIDMCKNLFKVEEVNC
ICVDWKKGSQTTYTQAANNARVVGAQVAQMLDILSTEYSYPPSKVHLIGHSLGAHVAGEA
GSKTPGLSRITGLDPVEASFEGTPEEVRLDPSDADFVDVIHTDAAPLIPFLGFGTNQQMG
HLDFFPNGGENMPGCKKNALSQIVDLDGIWAGTRDFVACNHLRSYKYYLESILDPDGFAA
YPCTSYKSFESDKCFPCPDQGCPQMGHYADKFAGRTSEDQQKFFLNTGEASNFARWRYGV
SITLSGRTATGQIKVALFGNKGNTQQYSIFRGILTPGSTHSYEFDAKLDVGTIEKVKFLW
NNNVINPTLPKVGAAKITVQKGEEKTVYNFCSEDTVREDTLLTLTPC
Download sequence
Identical sequences ENSMMUP00000003664 9544.ENSMMUP00000003664 ENSMMUP00000003664

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]