SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000003696 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000003696
Domain Number 1 Region: 467-738
Classification Level Classification E-value
Superfamily Kelch motif 3.4e-83
Family Kelch motif 0.00000109
Further Details:      
 
Domain Number 2 Region: 200-314
Classification Level Classification E-value
Superfamily POZ domain 1.6e-32
Family BTB/POZ domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000003696   Gene: ENSMMUG00000002755   Transcript: ENSMMUT00000003912
Sequence length 769
Comment pep:known chromosome:MMUL_1:5:34038406:34103767:1 gene:ENSMMUG00000002755 transcript:ENSMMUT00000003912 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NVIYFPLHLFVVYSRAYTSLVLVGCTNLCAVLFARCLDDHLVSLRMSGSRKEFDVKQILK
IRWRWFGHQASSPNSTVDSQQGEFWNRGQTGANGGRKFLDPCSLQLPLASIGYRRSSQLD
FQNSPSWPMASTSEVPAFEFTAEDCGGAHWLDRPEVDDGTSEEENESDSSSCRTSNSSQT
LSSCHTMEPCSSDEFFQALNHAEQTFKKMENYLRHKQLCDVILVAGDRRIPAHRLVLSSV
SDYFAAMFTNDVREARQEEIKMEGVEPNSLWSLIQYAYTGRLELKEDNIECLLSTACLLQ
LSQVVEACCKFLMKQLHPSNCLGIRSFADAQGCTDLHKVAHNYTMEHFMEVIRNQEFVLL
PASEIAKLLASDDMNIPNEETILNALLTWVRHDLEQRRKDLSKLLAYIRLPLLAPQFLAD
MENNALFRDDIECQKLIMEAMKYHLLPERRPMLQSPRTKPRKSTVGTLFAVGGIDSTKGA
TSIEKYDLRTNMWTPVANMNGRRLQFGVAVLDDKLYVVGGRDGLKTLNTVECYNPKTKTW
SVMPPMSTHRHGLGVAVLEGPMYAVGGHDGWSYLNTVERWDPQARQWNFVATMSTPRSTV
GVAVLSGKLYAVGGRDGSSCLKSVECFDPHTNKWTLCAQMSKRRGGVGVTTWNGLLYAIG
GHDAPASNLTSRLSDCVERYDPKTDMWTAVASMSISRDAVGVCLLGDKLYAVGGYDGQAY
LNTVEAYDPQTNEWTQVFSHSFEDSKNHLVAIKQTIQRQNSLSEEVRSH
Download sequence
Identical sequences 9544.ENSMMUP00000003696 ENSMMUP00000003696 ENSMMUP00000003696

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]