SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000003707 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000003707
Domain Number 1 Region: 13-174
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.04e-27
Family Ankyrin repeat 0.000000516
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000003707   Gene: ENSMMUG00000002760   Transcript: ENSMMUT00000003923
Sequence length 215
Comment pep:known chromosome:MMUL_1:10:13547036:13547706:-1 gene:ENSMMUG00000002760 transcript:ENSMMUT00000003923 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TEGCVSNLTVCNWAYSGKLEEVKERILANKSLAMRTDQDTSALHWAGSTRHTIAEFLFQL
GVPVNDKYYAMLTAVCAGQNETVKALGKGAQVNAVNQNGSTPLHHAVSKNRHEIAVMLLE
GEANPDGKDHYEATAKYRATAKGNLKMIHILLYYKASTNIQDTEGNTPPHLACDKSEEAK
LLVSQSNIYIENKEEKKPQVAKGGLGLILKRMVED
Download sequence
Identical sequences 9544.ENSMMUP00000038126 ENSMMUP00000038126 ENSMMUP00000003707

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]