SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000003724 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000003724
Domain Number 1 Region: 402-487
Classification Level Classification E-value
Superfamily Surp module (SWAP domain) 1.15e-24
Family Surp module (SWAP domain) 0.0011
Further Details:      
 
Domain Number 2 Region: 266-355
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 7.93e-21
Family Canonical RBD 0.004
Further Details:      
 
Domain Number 3 Region: 538-674
Classification Level Classification E-value
Superfamily ENTH/VHS domain 0.000000471
Family RPR domain (SMART 00582 ) 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000003724   Gene: ENSMMUG00000002775   Transcript: ENSMMUT00000003942
Sequence length 1029
Comment pep:known chromosome:MMUL_1:2:144814090:144868148:-1 gene:ENSMMUG00000002775 transcript:ENSMMUT00000003942 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADKTPGGSQKASSKTRSSDVHSSGSSDAHMDASGPSDSDMPSRTRPKSPRKHNYRNESA
RESLCDSPHQNLSRPLLENKLKAFSIGKMSTAKRTLSKKEQEELKKKEDEKAAAEIYEEF
LAAFEGSDGNKVKTFVRGGVVNAAKEEHETDEKRGKIYKPSSRFADQKNPPNQSSNERPP
SLLVIETKKPPLKKGEKEKKKSNLELFKEELKQIQEERDERHKTKGRLSRFEPPQSDSDG
QRRSMDAPSRRNRSSGVLDDYAPGSHDVGDPSTTNLYLGNINPQMNEEMLCQEFGRFGPL
ASVKIMWPRTDEERARERNCGFVAFMNRRDAERALKNLNGKMIMSFEMKLGWGKAVPIPP
HPIYIPPSMMEHTLPPPPSGLPFNAQPRERLKNPNAPMLPPPKNKEDFEKTLSQAIVKVV
IPTERNLLALIHRMIEFVVREGPMFEAMIMNREINNPMFRFLFENQTPAHVYYRWKLYSI
LQANSPTKWRTEDFRMFKNGSFWRPPPLNPYLHGMSEEQETEAFVEEPSKKGALKEEQRD
KLEEILRGLTPRKNDIGDAMVFCLNNAEAAEEIVDCITESLSILKTPLPKKIARLYLVSD
VLYNSSAKVANASYYRKFFETKLCQIFSDLNATYRTIQGHLQSENFKQRVMTCFRAWEDW
AIYPEPFLIKLQNIFLGLVNIIEEKETEDVPDDLDGAPIEEELDGAPLEDVDGIPIDATP
IDDLDGVPIKSLDDDLDGVPLDATEDSKKNEPSRKVPPSKWEAVDESELEAQAVTTSKWE
LFDQHEESEEEENQNQEEESEDEEDTQSSKSEEHHLYSNPIKEEMTESKFSKYSEMSEEK
RAKLREIELKVMKFQDELESGKRPKKPGQSFQEQVEHYRDKLLQREKEKELERERERDKK
DKEKLESRSKDKKEKDECTPTRKERKRRHSTSPSPSRSSSGRRVKSPSPKSERSERSERS
HKESSRSRSSHKDSPRDVSKKAKRSPSGSRTPKRSRRSRSRSPKKSGKKSRSQSRSPHRS
HKKSKKNKH
Download sequence
Identical sequences ENSMMUP00000003724 9544.ENSMMUP00000003724 ENSMMUP00000003724

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]