SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000003861 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000003861
Domain Number 1 Region: 296-459
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.46e-48
Family SPRY domain 0.0000516
Further Details:      
 
Domain Number 2 Region: 72-137
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000809
Family B-box zinc-binding domain 0.0021
Further Details:      
 
Domain Number 3 Region: 9-85
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000204
Family RING finger domain, C3HC4 0.024
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000003861
Domain Number - Region: 121-241
Classification Level Classification E-value
Superfamily Apolipoprotein A-I 0.000549
Family Apolipoprotein A-I 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000003861   Gene: ENSMMUG00000002890   Transcript: ENSMMUT00000004092
Sequence length 465
Comment pep:known chromosome:MMUL_1:4:29744160:29753216:1 gene:ENSMMUG00000002890 transcript:ENSMMUT00000004092 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSTPSLKVVHELPACTLCVGPLEDAVTAPCGHTFCRLCLPTLSQMGAQSSGKILLCPLC
QEEEQAETPMATVPLGPLGETYCEEHGEKIYFFCENDAEFLCVFCREGPTHQAHTVGFLD
EAIQPYRDRLRSRLEALSMERDEIEDVKCREDQKLQVLLTQIENKKHQVEAAFERLQQEL
EQQRCLLLARLKELEQQIWKERDEYITKVSEEVTRLGAQVKELEEKCQQPASELLQDVRV
NQSRCEMKTFVSPEAISPDLVKKIRDFHRKILTLPEMMRMFSENLAHHLEIDSGVITLDP
QTASRSLVLSEDRKSVRYTRQKKNLPDSPLRFDGLPAVLGFPGFSSGRHRWQVDLQLGDG
GGCTVGVAGEGVRRKGEMGLSAEDGVWAVIISHQQCWASTSPGTDLPLSEIPRYVGVALD
YEAGQVTLLNAQTQEPIFTFAASFSGKVFPFFAVWKKGSCLTLKG
Download sequence
Identical sequences F7HDH4
ENSMMUP00000003861 ENSMMUP00000003861 9544.ENSMMUP00000003861

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]